SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000003828 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000003828
Domain Number 1 Region: 291-380
Classification Level Classification E-value
Superfamily Ricin B-like lectins 0.000000167
Family Ricin B-like 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000003828   Gene: ENSAMEG00000003637   Transcript: ENSAMET00000003983
Sequence length 500
Comment pep:novel scaffold:ailMel1:GL193109.1:223260:364561:1 gene:ENSAMEG00000003637 transcript:ENSAMET00000003983 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LNLALHEQKEKITEKVILSMTAKEHHKAQEEVSRLIDELQTAIKSNRGHLSKLGPQLQAE
QEQFSSYVYQHIKSLPANTLIPGGLQLKIFESGKGTGEISVCISKKDLESNSPTQTGDMM
EKLLLQIHQRLKESPMNSSGLSFSSIRLFNEHGQEIKNPLVLKNEQKIWVSYGKAYRSPL
TPVLSLTFDQVTAFDRDGITVVYKTFLDPNAVLLPGCDNWEVCERFPININGTSQQIPDQ
FEKVDLENHFLQNKVDPSIVLHASVSIRKRSSTSREVSSGGQTVPSILWPAASVWLITKT
GMILSRVITQGCLAIGHPIRVKAAEGTSLEGYKLILQKRHKGDNSQKWVFGTDSCIYSKA
YPQFVLTYLEELTGQVDVTQTEYPIHHGAWTTTHQKHGSSLAEEVLQESASIPGLKQLPE
PSDTHLMPEGSLGETKQLTVALVRKLEEKHPKASAQRWAIKHEGTNKPGQWKHSKVENPL
WNKLTYMWPVLPSGQLNEVV
Download sequence
Identical sequences D2HP01
ENSAMEP00000003828 ENSAMEP00000003828

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]