SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000003835 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000003835
Domain Number 1 Region: 4-102
Classification Level Classification E-value
Superfamily Doublecortin (DC) 0.00000000000000615
Family Doublecortin (DC) 0.011
Further Details:      
 
Domain Number 2 Region: 485-565
Classification Level Classification E-value
Superfamily Doublecortin (DC) 0.00000000000183
Family Doublecortin (DC) 0.006
Further Details:      
 
Domain Number 3 Region: 243-345
Classification Level Classification E-value
Superfamily Ricin B-like lectins 0.000000126
Family Ricin B-like 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000003835   Gene: ENSAMEG00000003642   Transcript: ENSAMET00000003990
Sequence length 648
Comment pep:novel scaffold:ailMel1:GL193109.1:374405:412129:1 gene:ENSAMEG00000003642 transcript:ENSAMET00000003990 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRKTICKTPELCVPVRLRVLRNGDKNKNRAFVIIGPDVSPGRKMQCTEILNLPSAARRLF
NEKGKEIFALKDLQRDELKFISCGEHWINPDVSIAQQKKQIFLRNLASDIYKIQAFCSIH
KIEALVLEVQSDIVSGAKLAVHKPVAIFGEEKQMIGPKEKQMQKNALTTEKAFSEVLDSH
ARAHLRMKACHTLLRYTWQETPQDFDEDDSLPKKMEEELFENEESLKKYSHSPKQNKLQK
LCHQQFEYRNGQIISCAAPQLVLGVRGPDVRSGMEVVLVEKKVDDCHQRWMHKEGSRTFH
LVGNPDLVLAVSMTKTRNEVCGYPVIVQKYKPYNNGTANQKWNFVENIKAFMAFYSTALD
KEITAANYAGICTSSVIKGENIDQPGYYYVSLTGKNKTMLCLACGRSLRAEKGLKPLLPG
LPFFCASGSKTRKPLSRGPFKVISVAKADLSSYEAEKTLSYYEERLLSLRMKTCTQVVSR
SGMAATHQQAVKIIAYKNGDGYRNGKLIVAGTFPTLLAECTEQLGLPRAASKVYVKDGTT
ILSLRDLVLWALEESFIQRNTEKQKKEAVPIRTKETTITKNPRMKVNTKLFPKSVTSDSL
DGIDKSLLTLVLRNPIAIWVSCGEPFLSPKESRKVRKTELAKKGQNFG
Download sequence
Identical sequences G1LAB2
ENSAMEP00000003835 ENSAMEP00000003835

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]