SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000003956 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000003956
Domain Number 1 Region: 4-56
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 8.13e-20
Family Ribosomal protein L24e 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000003956   Gene: ENSAMEG00000003740   Transcript: ENSAMET00000004116
Sequence length 157
Comment pep:known_by_projection scaffold:ailMel1:GL192515.1:260584:264970:1 gene:ENSAMEG00000003740 transcript:ENSAMET00000004116 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YRVELCSFSGYKIYPGHGRRYARTDGKVFQFLNAKCESAFLSKRNPRQINWTVLYRRKHK
KGQSEEIQKKRTRRAVKFQRAITGASLADIMAKRNQKPEVRKAQREQAIRAAKEAKKAKQ
ASKKTAMAAAKAPTKAAPKQKIVKPVKVSAPRVGGKR
Download sequence
Identical sequences G1LAN3 M3YJY7 W5QAY7
ENSCPOP00000016020 ENSCPOP00000016020 10141.ENSCPOP00000016020 9615.ENSCAFP00000014113 ENSOARP00000019882 ENSMPUP00000011644 ENSSSCP00000012733 ENSAMEP00000003956 ENSMPUP00000011644 ENSSSCP00000012733 ENSAMEP00000003956

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]