SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000004191 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000004191
Domain Number 1 Region: 342-471
Classification Level Classification E-value
Superfamily C-type lectin-like 1.37e-41
Family C-type lectin domain 0.0000877
Further Details:      
 
Domain Number 2 Region: 199-334
Classification Level Classification E-value
Superfamily C-type lectin-like 2.32e-37
Family C-type lectin domain 0.00042
Further Details:      
 
Domain Number 3 Region: 791-917
Classification Level Classification E-value
Superfamily C-type lectin-like 2.02e-34
Family C-type lectin domain 0.00038
Further Details:      
 
Domain Number 4 Region: 482-617
Classification Level Classification E-value
Superfamily C-type lectin-like 4.3e-34
Family C-type lectin domain 0.0011
Further Details:      
 
Domain Number 5 Region: 930-1081
Classification Level Classification E-value
Superfamily C-type lectin-like 1.69e-33
Family C-type lectin domain 0.00039
Further Details:      
 
Domain Number 6 Region: 625-775
Classification Level Classification E-value
Superfamily C-type lectin-like 4.39e-29
Family C-type lectin domain 0.00052
Further Details:      
 
Domain Number 7 Region: 1220-1360
Classification Level Classification E-value
Superfamily C-type lectin-like 6.47e-27
Family C-type lectin domain 0.0017
Further Details:      
 
Domain Number 8 Region: 1088-1215
Classification Level Classification E-value
Superfamily C-type lectin-like 5.4e-25
Family C-type lectin domain 0.0012
Further Details:      
 
Domain Number 9 Region: 5-136
Classification Level Classification E-value
Superfamily Ricin B-like lectins 1.04e-24
Family Cysteine rich domain 0.0051
Further Details:      
 
Domain Number 10 Region: 136-194
Classification Level Classification E-value
Superfamily Kringle-like 1.54e-20
Family Fibronectin type II module 0.00079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000004191   Gene: ENSAMEG00000003894   Transcript: ENSAMET00000004358
Sequence length 1438
Comment pep:known_by_projection scaffold:ailMel1:GL192886.1:666898:688330:-1 gene:ENSAMEG00000003894 transcript:ENSAMET00000004358 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SLPEPNVFLIFSHGLQGCLEAQGGQVRVSPACNASLPAQRWKWVSRNRLFSLGTMQCLGT
GWPGTNTTASLGMYECDREALNLRWHCRTLGDQLSQLLGGRTSNTSKAGGPERGDQTRSG
QWRIYGSDEDLCARPYYEVYTIQGNSHGKPCTIPFKYDNQWFHSCTSTGREDGHLWCATT
QDYGKDERWGFCPIKSNDCETFWDKDQLTDSCYQFNFQSTLSWREAWASCEQQGADLLSI
TEIHEQTYINGLLTGYSSTLWIGLNDLDTSGGWQWSDNSPLKYLNWESDQPDNPSEENCG
VIRTESSGGWQNRDCSIALPYVCKKKPNATAERPPPDVWANVKVECEPSWQPFQGHCYRL
QAEKRSWQESKKACLRGGGDLLSIHSMAELEFITKQIKQEVEELWIGLNDLKLQMNFEWS
DGSLVSFTHWHPFEPNNFRDSLEDCVTIWGPEGRWNDSPCNQSLPSICKKAGQLSQGAAE
EDHGCRKGWTWHSPSCYWLGEDQVTYSEARRLCTDHGSQLVTITNRFEQAFVSSLIYSWD
GEYFWTALQDLNSTGSFRWLSGDEVMYTHWNRDQPGYSRGGCVALATGSAMGLWEVKNCT
AFRARYICRQSLGTPVTPELPGPDPTPSLTGSCPQGWGSDPKLRHCYKVFSSERLQDKKT
WVQAQGACQELGAQLLSLASYEEEHFVANMLNKIFGESEPEIHEQNWFWIGLNRRDPGAG
QSWRWSDGLGFSYHNFDRSRHDDDDIRGCAVLDLASLQWVAMQCETQLDWICKIPRGTDV
QEPDVSPQGRREWLRFQEAEYKFFEHHSTWAQAQRICTWFQAELASVHSQAELDFLGHNL
QKLSRGQEQHWWIGLHTAESDGRFRWTDGSVINFISWAPGKPRPIGKDKKCVYMTASRED
WGDQRCLTALPYICKRSNSTGEPQPPDLPPTALGGCPSGWNQFLNKCFRIQGQDPQDRVK
WSEAQFSCEQQEAQLVTIANPLEQAFITASLPNVTFDLWIGLHASQRDFQWVEQEPLLYT
NWAPGEPSGPSPAPSGNIPTSCAVVLHSPSAHFTGRWDDRSCTEETHGFICQKGTDPSLS
PSPAASPPAPGTELSYLNGTFRLLQKPLRWHDALLLCESRNASLAHVPDPYTQAFLTQAA
RGLRTPLWIGLASEEMAPSCSWVSEEPLSYVSWQDGEPQQPGGCAYVDVDGTWRTASCDT
KLQGAVCGVNGGPPPPRRISYHGSCPQGLADSAWIPFREHCYSFHMELLLGHKEALQRCQ
RAGGAVLSILDEMENVFVWEHLQSSEGQSRGAWLGMNFNPKGGTLVWQDNTAVNYSNWGP
PGLGPSMLSHNSCYWIQSSSGLWRPGACTNITMGVVCKLPRAEETSFSPSAALPENPAAL
VVVLLALLTAALILYRRRQSAERGTFEGARYSRSASGPGEATEKNILVSDMEMNEQQE
Download sequence
Identical sequences G1LBB7
ENSAMEP00000004191

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]