SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000004244 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000004244
Domain Number 1 Region: 32-408
Classification Level Classification E-value
Superfamily RNI-like 3.14e-56
Family Cyclin A/CDK2-associated p19, Skp2 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000004244   Gene: ENSAMEG00000004009   Transcript: ENSAMET00000004414
Sequence length 436
Comment pep:known_by_projection scaffold:ailMel1:GL192497.1:161854:241439:1 gene:ENSAMEG00000004009 transcript:ENSAMET00000004414 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRDVNGVTKSRFEMFSNSDEAVINKKLPKELLLRIFSFLDVVTLCRCAQVSRAWNVLAL
DGSNWQRIDLFDFQRDIEGRVVENISKRCGGFLRKLSLRGCLGVGDNALRTFAQNCRNIE
VLNLNGCTKTTDATCTSLSKFCSKLRHLDLASCTSITNMSLKALSEGCPLLEQLNISWCD
QVTKDGIQALVRGCGGLKALFLKGCTQLEDEALKYIGAHCPELVTLNLQTCLQITDEGLI
TICRGCHKLQSLCASGCSNITDAILNALGQNCPRLRILEVARCSQLTDVGFTTLARNCHE
LEKMDLEECVQITDSTLIQLSIHCPRLQVLSLSHCELITDDGIRHLGNGACAHDQLEVIE
LDNCPLITDASLEHLKSCHSLERIELYDCQQITRAGIKRLRTHLPNIKVHAYFAPVTPPP
SVGGSRQRFCRCCIIL
Download sequence
Identical sequences A0A0D9S3C4 A0A0P6JWS1 A0A1S3A8F3 A0A1U7QKQ8 A0A2I3SY70 A0A2J8W9X8 A0A2K5EWM8 A0A2K6DQ70 A0A2K6FBD5 A0A2K6Q4C1 A0A2K6S1V6 E2R3V0 F6ZWN4 G1LBH0 G3R2L6 G7NH38 G7PUL5 H0VRK2 I3NG45 Q58DG6 Q96IG2
NP_116264.2.87134 NP_116264.2.92137 XP_001172452.1.37143 XP_002748565.1.60252 XP_002916841.2.58354 XP_003483043.1.46622 XP_003931235.1.74449 XP_004282766.1.21590 XP_004434636.1.5094 XP_004591196.1.84141 XP_004633756.1.9945 XP_004764726.1.14098 XP_004859567.1.39548 XP_005075981.1.91757 XP_005624619.1.84170 XP_005964796.1.78601 XP_006068610.1.26621 XP_006176426.1.101512 XP_006214301.1.17985 XP_006832610.1.41390 XP_006971911.1.50099 XP_007112614.1.24612 XP_007465216.1.90284 XP_007530998.1.11023 XP_008011062.1.81039 XP_008521484.1.77740 XP_010377618.1.97406 XP_010840975.1.44457 XP_010958788.1.22495 XP_010990135.1.51371 XP_011382598.1.92234 XP_011723629.1.29376 XP_011840119.1.47321 XP_011840120.1.47321 XP_012307361.1.9421 XP_013005052.1.53824 XP_014689024.1.49734 XP_014975016.1.72884 XP_015454783.1.64745 XP_016020120.1.101085 XP_019271547.1.44245 XP_019494247.1.44202 XP_019494248.1.44202 XP_019780546.1.83887 XP_019836799.1.53367 XP_020757429.1.74333 ENSCAFP00000024224 ENSBTAP00000011020 ENSPTRP00000015488 ENSCJAP00000049638 ENSCPOP00000013218 10141.ENSCPOP00000013218 9598.ENSPTRP00000015488 9606.ENSP00000264658 9615.ENSCAFP00000024224 ENSAMEP00000004244 ENSCPOP00000013218 ENSP00000264658 ENSP00000462271 ENSTTRP00000007992 ENSPTRP00000015488 ENSCAFP00000024224 ENSSSCP00000018553 ENSBTAP00000011020 ENSTTRP00000007992 ENSAMEP00000004244 ENSSSCP00000018553 gi|27734755|ref|NP_116264.2| ENSCJAP00000015818 ENSP00000264658 ENSP00000462271

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]