SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000005423 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000005423
Domain Number 1 Region: 306-592
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.7e-82
Family Protein kinases, catalytic subunit 0.000000000129
Further Details:      
 
Domain Number 2 Region: 810-920
Classification Level Classification E-value
Superfamily FAT domain of focal adhesion kinase 2.49e-43
Family FAT domain of focal adhesion kinase 0.00000121
Further Details:      
 
Domain Number 3 Region: 105-213
Classification Level Classification E-value
Superfamily PH domain-like 2.34e-37
Family Third domain of FERM 0.00000122
Further Details:      
 
Domain Number 4 Region: 1-104
Classification Level Classification E-value
Superfamily Second domain of FERM 1.12e-32
Family Second domain of FERM 0.00000194
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000005423   Gene: ENSAMEG00000005104   Transcript: ENSAMET00000005648
Sequence length 926
Comment pep:known_by_projection scaffold:ailMel1:GL192770.1:1280304:1415782:-1 gene:ENSAMEG00000005104 transcript:ENSAMET00000005648 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QVKSDYMSEIADRVDQDIALKLGCLEIRRSYWEMRGNALEKKSNYEVLEKDVGLKRFFPR
SLLDSVKAKTLRKLIQQTFRQFANLNREESILKFFEILSPVYRFDKECFKCALGSSWIIS
VELAIGPEEGISYLTDKGCNPTHLADFNQVQTIQYSNSEDKDRKGMLQLKIAGAPEPLTV
TAPSLTIAENMADLIDGYCRLVNGASQSFIIRPQKEGERALPSIPKLANSEKQGVRTHAV
SVSGVSPCQHKVKKARRFLPLVFCSHEPLPGSTDEISGDETDDYAEIIDEEDTYTMPSKS
YGIDEARDYEIQRERIELGRCIGEGQFGDVHQGVYMSPENPALAVAIKTCKNCTSDSVRE
KFLQEALTMRQFDHPHIVKLIGVITENPVWIIMELCTLGELRSFLQVRKYSLDLASLILY
AYQLSTALAYLESKRFVHRDIAARNVLVSSNDCVKLGDFGLSRYMEDSTYYKASKGKLPI
KWMAPESINFRRFTSASDVWMFGVCMWEILMHGVKPFQGVKNNDVIGRIENGERLPMPPN
CPPTLYSLMTKCWAYDPSRRPRFTELKAQLSTILEEEKVQQEERMRMESRRQVTVSWDSG
GPDEAPPKPSRPGYPSPRSSEGFYPSPQHMVQTNHYQVSGYPGSHGITAMAGSVYPGQAS
LLDQTDSWNHRQQEVSMWQPNVEDSAALDLRGIGQVLPAHLMEERLIRQQQEMEEDQRWL
EKEERFLKPDVRLSRGSIDREDGGLQGPTGNQHIYQPVGKPDPAAPPKKPPRPGAPGHLG
SLASLSSPGDSYNEGVKPWRLQPQEISPPLEMSSKIQPAPPEEYVPMVKEVGLALRTLLA
TVDETLPVLPAGTHREIEMAQKLLNSDLGELINKMKLAQQYVMTSLQQEYKKQMLTAAHA
LAVDAKNLLDVIDQARLRMLGTTRPH
Download sequence
Identical sequences G1LET6
ENSAMEP00000005423 ENSAMEP00000005423

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]