SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000006290 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000006290
Domain Number 1 Region: 228-482
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.1e-72
Family Protein kinases, catalytic subunit 0.000000106
Further Details:      
 
Domain Number 2 Region: 117-252
Classification Level Classification E-value
Superfamily SH2 domain 2.02e-31
Family SH2 domain 0.00000171
Further Details:      
 
Domain Number 3 Region: 51-140
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000108
Family SH3-domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000006290   Gene: ENSAMEG00000005916   Transcript: ENSAMET00000006548
Sequence length 507
Comment pep:known_by_projection scaffold:ailMel1:GL193044.1:919735:927977:-1 gene:ENSAMEG00000005916 transcript:ENSAMET00000006548 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DVGQGSLGSWATLWALQQVSARPQVRPHFLCAWHPTFISARMPTRRWAPGTQCITKCEHT
RPKPGELAFHKGDVVTILEACESKSWYRAKHHASGQEGLLAAGALREREALSADPKLSLM
PWFHGKISGQEAVQQLQPPEDGLFLVRESARHPGDYVLCVSFGRDVIHYRVLHRDGHLTI
DEAVCFCNLMDMVRHYSKDKGAICTKLVKPKRKQGTKSAEEELAKAGWLLNLQHLTLGAQ
IGEGEFGAVLQGEYLGQKVAVKNIKCDVTAQAFLDETAVMTKMQHKNLVRLLGVILHQGL
YIVMEHVSKGNLVNFLRTRGRALVSTPQLLQFSLHVAEGMEYLENKKLVHRDLAARNILI
SEDLVAKVSDFGLAKAERKGLDSSRLPVKWTAPEALKHGKFSSKSDVWSFGVLLWEVFSY
GRAPYPKMSLKEVSEAVEKGYRMEPPEGCPGPVHALMGSCWEAEPARRPPFRKLAEKLAR
ELRSTDASAPVGGQDMDSSPLPRGQEP
Download sequence
Identical sequences G1LH96
ENSAMEP00000006290 ENSAMEP00000006290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]