SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000006749 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000006749
Domain Number 1 Region: 655-929
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.2e-59
Family Protein kinases, catalytic subunit 0.0000000464
Further Details:      
 
Domain Number 2 Region: 33-219
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.21e-55
Family Ephrin receptor ligand binding domain 0.00000552
Further Details:      
 
Domain Number 3 Region: 359-572
Classification Level Classification E-value
Superfamily Fibronectin type III 1.37e-33
Family Fibronectin type III 0.0000595
Further Details:      
 
Domain Number 4 Region: 950-1020
Classification Level Classification E-value
Superfamily SAM/Pointed domain 8.17e-16
Family SAM (sterile alpha motif) domain 0.0015
Further Details:      
 
Domain Number 5 Region: 288-352,398-418
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000107
Family Growth factor receptor domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000006749   Gene: ENSAMEG00000006351   Transcript: ENSAMET00000007033
Sequence length 1025
Comment pep:known_by_projection scaffold:ailMel1:GL193114.1:281960:288597:1 gene:ENSAMEG00000006351 transcript:ENSAMET00000007033 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAEGAARSGSGVAGMVCSLWVLVLGSSVLALEEVLLDTTGETSEIGWLTYPPGGWDEVS
VLDDQRRLTRTFEACHVAGAPPGTGQDNWLQTHFVERRGAQRAHIRLHFSVRACASLGVA
GGTCRETFTLYYRQAEEPDGPDSVAAWHLKRWTKVDTIAADESFPASSAWAVAPHGAGQR
AGLQLNVKERSFGPLTQRGFYVAFQDTGACLALVAVKLFSYTCPSVLHAFASFPETQASG
AGGASLVAAVGTCVVHAEPEEDGGSGQAGGSPPRLHCNGEGKWMVAVGGCRCQPGYQPAG
GDKACQACPEGSYKALAGNAPCLPCPARSQAPDPAAPVCPCLEGFYRAGSDPPEAPCTGP
PSAPRELWFEVQGSVLMLHWRLPQELGGRGDLLFNVVCKECGGHQEPGSGTGGACRRCRD
EVHFDPRQRGLTESRVLVGGLRAHVPYILEVQAVNGVSELSPDPPQAAAINVSTSHAVPS
AVPALHQVSRASNSITVSWPQPDQTNGNILDYQLRYYDQAEDESHSFTLTSETNTATVTQ
LSPGHIYGFQVRARTAAGHGPYGGKVYFQTLPQGELSTQLPERLSLVIGSILGALAFLLL
AAITVLAVVFQRKRRGTGYTEQLQQYSSPAGLGVKYYIDPSTYEDPCQAIREFTREVDPA
YIKIEEVIGAGSFGEVRRGRLQPRGRREQAVAIQALWAGGAESLQMTFLGQAAVLGQFQH
PNILRLEGVVTKSRPLMVLTELMELGPLDSFLRQQREGQFSSLQLVAMQRGVAAAMQYLS
SFAFVHRALSARSVLVNSHLVCKVARLGHSPQTATVASNPTPQGPSCMLRWAAPEVIAHG
KHTTCSDVWSFGIVMWEVMSYGERPYWDMSDQEVLNAIEQEFRLPPPPGCPPGLHLLMLD
TWQKDRTQRPHFDQLVAAFDKMIRKPDTLQADGGPGDRPSQALLNPVSLDFPSLDSPQAW
LSAIGLECYQDNFSKFGLCTFSDVAQLSLEDLPALGIMLAGHQKKLLHNVQLLQQHLRGL
GSVEV
Download sequence
Identical sequences G1LIJ6
ENSAMEP00000006749 ENSAMEP00000006749

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]