SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000006850 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000006850
Domain Number 1 Region: 1124-1319
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.2e-57
Family BCR-homology GTPase activation domain (BH-domain) 0.0000239
Further Details:      
 
Domain Number 2 Region: 906-1029
Classification Level Classification E-value
Superfamily PH domain-like 3.84e-32
Family Pleckstrin-homology domain (PH domain) 0.000000497
Further Details:      
 
Domain Number 3 Region: 15-43,71-143
Classification Level Classification E-value
Superfamily PDZ domain-like 1.05e-19
Family PDZ domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000006850   Gene: ENSAMEG00000006453   Transcript: ENSAMET00000007136
Sequence length 1913
Comment pep:known_by_projection scaffold:ailMel1:GL192355.1:4317604:4393065:-1 gene:ENSAMEG00000006453 transcript:ENSAMET00000007136 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VSKSKDGKEQSETISPSEDETFSWPGPKTVVLKRTSQGFGFTLRHFIVYPPESAIQFSYK
DEENGNREVNNGKQRNRLEPMDTIFVKQVKEGGPAFEAGLCTGDRIIKVNGESVIGKTYS
QVIALIQNSDTTLELSVMPKDEDILQVAYSQDAYLKGNEAYSGNARNIPEPPPVCYPWLP
SAPSAMAQPVEISPPDSSSSKQQTSTPILMQPGRAYRMEIQVPPSPTDVAKSNTAVCVCN
ESVRTVIVPSEKVVDLLTNRNNHTVPSHRTEEVRYGINEQTSLKTVSRTTSPSSSIPTAH
LIHQTAGSRSLEPSGILLKSGNYSGHSEGISSSRPQAVDSPSVSVNHYSPNSHQHIDWKN
YKTYKEYIDNRRLHIGCRTIQERLDSLRAASQSTTDYNQVVPNRTTLQVRRRSTSHDRVP
QSVQIRQRSVSQERLEDSVLMKYCPRSASQGALTSPSVSFSNHRTRSWDYIEGQGETLEN
VNSESQIPDSNGERKQTYKWSGFTEQDDRRGIYERPRQQEIHKSFRGSNFTVAPSVVNSD
NRRMPGRGVGSVSQFKKVPPDLKTVQSNRNFPTTCGMSLPRGISQDRSPLVKVRSNSLKA
HVTKPSFSQNSFVSVKDQRPVNHLHQNSLLNQQTWLRTESAPDHQVEPGKPPSFPGAPVK
PAPQPTENSGASEIESSVAQRNQDFDLREAEIQESSTLDNRETVVLREKPPSGRQTPQPL
RHQSYILAVNDQETGSDTTCWLPNDARREVHIKRMEERKASSTSPPGDSLASIPFIDEPT
SPSIDHDLAHIPASAVISASTPQAPQAPSIAMVPPSLTTSAPLIRRQLSHDQESVGPPSL
DAQPSSKTERSKSYDEGLDDYREDAKLSFKHVSSLKGIKIVDSQKSSEDSGSRKDSSSEV
FSDAAKEGWLHFRPLVTDKGKRVGGSIRPWKQMYVVLRGHSLYLYKDKREQMTPSEEEQP
ISVNACLIDISYSETKRKNVFRLTTSDCECLFQAEDRDDMLAWIKTIQESSNLNEEDTGV
TNRDLISRRIKEYNSLMSSFSSKAEQLPKTPRQSLSIRQTLLGAKSEPKTQSPHSPKEES
ERKLLSKEQSKDDTSPPKDKGTWRKGIPSIMRKTFEKKPTATGTFGVRLDDCPPAHTNRY
IPLIVDICCKLVEERGLEYTGIYRVPGNNAAISSMQEELNKGMADIDIQDDKWRDLNVIS
SLLKSFFRKLPEPLFTNDKYADFIEANRKEDPLDRLKTLKRLIHDLPEHHYETLKFLSAH
LKTVAENSEKNKMEPRNLAIVFGPTLVRTSEDNMTHMVTHMPDQYKIVETLIQHHDWFFT
EEGVEEPLTTVQEENTVDSQPVPNIDHLLTNIGRTGVSPGDVSDSATSDSTKSKGSWGSG
KDQYSRELLVSSIFAAASRKRKKPKEKAQPSSSEDELDNVFFKKENTEHSHNDIKEESKK
ESETLCRKQRITVSKENNAKKDLGATKDDKTPPRKESGQSEEPSLPHSAKPRKSPTPSCR
FPALRERPRSPGTPKSSHFEETGSDSGTLLSTSSQASLTRFSSKRSTSPETKAAFLAAVS
TLTSDYSTTSSSAYPTSLDGSRLSPDVRSVAESRGDEADDERSELISEGRPAETPVETDS
ETDFPVFPAALPSDRLFRGKLQDASKASRRNSEGSEASCTEGSLTPSLDSRRQLFSSHKL
IECDTLSRKKSARFKSDSSSLGDAKSDRETPAITKVFDVMKKGRSTGSLLTPTRSESEKQ
EPTWKTKIADRLKLRPRAPADDMFGVGTQKASAEAAKRKNIKRRHTLGGHRDAAEMSVLN
FWKAHEQGGEREAELSAVNRLKPKCSAQDLSISDWLARERLRTSASDLSRAETGDPPPAL
VASTTRPLLSIPPQSPEQINGESFQNMSQNHYNAQPHKLSGTPGNKAQFHPCL
Download sequence
Identical sequences G1LIU6
ENSAMEP00000006850

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]