SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000006873 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000006873
Domain Number 1 Region: 1144-1339
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.26e-51
Family BCR-homology GTPase activation domain (BH-domain) 0.0000546
Further Details:      
 
Domain Number 2 Region: 934-1057
Classification Level Classification E-value
Superfamily PH domain-like 4.11e-32
Family Pleckstrin-homology domain (PH domain) 0.000000497
Further Details:      
 
Domain Number 3 Region: 36-161
Classification Level Classification E-value
Superfamily PDZ domain-like 7.1e-20
Family PDZ domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000006873   Gene: ENSAMEG00000006453   Transcript: ENSAMET00000007161
Sequence length 1957
Comment pep:known_by_projection scaffold:ailMel1:GL192355.1:4317607:4449244:-1 gene:ENSAMEG00000006453 transcript:ENSAMET00000007161 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMATRRTGLPEGDGDKLKACEVSKSKDGKEQSETISPSEDETFSWPGPKTVVLKRTSQGF
GFTLRHFIVYPPESAIQFSYKDEENGNREGKQRNRLEPMDTIFVKQVKEGGPAFEAGLCT
GDRIIKVNGESVIGKTYSQVIALIQNSDTTLELSVMPKDEDILQVLQFTKDVTALAYSQD
AYLKGNEAYSGNARNIPEPPPVCYPWLPSAPSAMAQPVEISPPDSSSSKQQTSTPILMQP
GRAYRMEIQVPPSPTDVAKSNTAVCVCNESVRTVIVPSEKVVDLLTNRNNHTVPSHRTEE
VRYGINEQTSLKTVSRTTSPSSSIPTAHLIHQTAGSRSLEPSGILLKSGNYSGHSEGISS
SRPQAVDSPSVSVNHYSPNSHQHIDWKNYKTYKEYIDNRRLHIGCRTIQERLDSLRAASQ
STTDYNQVVPNRTTLQVRRRSTSHDRVPQSVQIRQRSVSQERLEDSVLMKYCPRSASQGA
LTSPSVSFSNHRTRSWDYIEGQGETLENVNSESQIPDSNGERKQTYKWSGFTEQDDRRGI
YERPRQQEIHKSFRGSNFTVAPSVVNSDNRRMPGRGVGSVSQFKKVPPDLKTVQSNRNFP
TTCGMSLPRGISQDRSPLVKVRSNSLKAHVTKPSFSQNSFVSVKDQRPVNHLHQNSLLNQ
QTWLRTESAPDHQVEPGKPPSFPGAPVKPAPQPTENSGASEIESSVAQRNQDFDLREAEI
QESSTLDNRETVVLREKPPSGRQTPQPLRHQSYILAVNDQETGSDTTCWLPNDARREVHI
KRMEERKASSTSPPGDSLASIPFIDEPTSPSIDHDLAHIPASAVISASTPQAPQAPSIAM
VPPSLTTSAPLIRRQLSHDQESVGPPSLDAQPSSKTERSKSYDEGLDDYREDAKLSFKHV
SSLKGIKIVDSQKSSEDSGSRKDSSSEVFSDAAKEGWLHFRPLVTDKGKRVGGSIRPWKQ
MYVVLRGHSLYLYKDKREQMTPSEEEQPISVNACLIDISYSETKRKNVFRLTTSDCECLF
QAEDRDDMLAWIKTIQESSNLNEEDTGVTNRDLISRRIKEYNSLMSKAEQLPKTPRQSLS
IRQTLLGAKSEPKTQSPHSPKEESERKLLSKDDTSPPKDKGTWRKGIPSIMRKTFEKKPT
ATGTFGVRLDDCPPAHTNRYIPLIVDICCKLVEERGLEYTGIYRVPGNNAAISSMQEELN
KGMADIDIQDDKWRDLNVISSLLKSFFRKLPEPLFTNGEYFIFLEVQLKFSLLIHRENNM
FQIHDLPEHHYETLKFLSAHLKTVAENSEKNKMEPRNLAIVFGPTLVRTSEDNMTHMVTH
MPDQYKIVETLIQHHDWFFTEEGVEEPLTTVQEENTVDSQPVPNIDHLLTNIGRTGVSPG
DVSDSATSDSTKSKGSWGSGKDQYSRELLVSSIFAAASRKRKKPKEKAQPSSSEDELDNV
FFKKENTEHSHNDIKEESKKESETLCRKQRITVSKENNAKKDLGATKDDKTPPRKESGQS
EEPSLPHSAKPRKSPTPSCRFPALRERPRSPGTPKSSHFEETGSDSGTLLSTSSQASLTR
FSSKRSTSPETKRAFLAAVSTLTSDYSTTSSSAYPTSLDGSRLSPDVRSVAESRGDEADD
ERSELISEGRPVETDSETDFPVFPAALPSDRLFRGKLQDASKASRRNSEGSEASCTEGSL
TPSLDSRRQLFSSHKLIECDTLSRKKSARFKSDSSSLGDAKSDRETPAITKVFDVMKKGR
STGSLLTPTRSESEKQEPTWKTKIADRLKLRPRAPADDMFGVGTQKASAEAAKRKNIKRR
HTLGGHRDAAEMSVLNFWKAHEQGGEREAELSAVNRLKPKCSAQDLSISDWLARERLRTS
ASDLSRAETGDPPPALXXXXXXXXXXXXXXXXXXXXXXXXXXASTTRPLLSIPPQSPEQI
NGESFQNMSQNASSAANAQPHKLSGTPGNKAQFHPCL
Download sequence
Identical sequences G1LIW9
ENSAMEP00000006873 ENSAMEP00000006873

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]