SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000006922 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000006922
Domain Number 1 Region: 266-535
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.22e-81
Family Protein kinases, catalytic subunit 0.000000000324
Further Details:      
 
Domain Number 2 Region: 127-256
Classification Level Classification E-value
Superfamily SH2 domain 2.11e-38
Family SH2 domain 0.00000701
Further Details:      
 
Domain Number 3 Region: 79-148
Classification Level Classification E-value
Superfamily SH3-domain 3.88e-19
Family SH3-domain 0.0000809
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000006922   Gene: ENSAMEG00000006544   Transcript: ENSAMET00000007212
Sequence length 543
Comment pep:known_by_projection scaffold:ailMel1:GL192929.1:421195:442649:1 gene:ENSAMEG00000006544 transcript:ENSAMET00000007212 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IMGCIKSKENKSPTIKYRTENTPEPVSTSVSHYGAEHTAVAASSSTKGASVNFNSLSMTP
FGGSSGVTPFGGASSSFSVVPSSYPAGLTGGVTIFVALYDYEARTTEDLSFKKGERFQII
NNTEGDWWEARSIATGKNGYIPSNYVAPADSIQAEEWYFGKMGRKDAERLLLNPGNQRGI
FLVRESETTKVGAYSLSIRDWDEVRGDNVKHYKIRKLDNGGYYITTRAQFDTLQKLVKHY
TEHADGLCHKLTTVCPTVKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTT
KVAIKTLKPGTMMPEAFLQEAQIMKKLRHDKLVPLYAVVSEEPIYIVTEFMSKGSLLDFL
KEGDGKYLKLPQLVDMAAQIADGMAYIERMNYIHRDLRAANILVGENLVCKIADFGLARL
IEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILQTELVTKGRVPYPGMVNRE
VLEQVERGYRMPCPQGCPESLHELMNLCWKKDPDERPTFEYIQSFLEDYFTATEPQYQPG
ENL
Download sequence
Identical sequences G1LJ17
ENSAMEP00000006922 ENSAMEP00000006922

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]