SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000007326 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000007326
Domain Number 1 Region: 5050-5208
Classification Level Classification E-value
Superfamily SET domain 8.76e-49
Family Histone lysine methyltransferases 0.0065
Further Details:      
 
Domain Number 2 Region: 1130-1190
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000000487
Family PHD domain 0.0039
Further Details:      
 
Domain Number 3 Region: 275-326
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000000093
Family PHD domain 0.0022
Further Details:      
 
Domain Number 4 Region: 1205-1273
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000109
Family PHD domain 0.024
Further Details:      
 
Domain Number 5 Region: 1084-1138
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000111
Family PHD domain 0.017
Further Details:      
 
Domain Number 6 Region: 224-277
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000144
Family PHD domain 0.01
Further Details:      
 
Domain Number 7 Region: 1735-1785
Classification Level Classification E-value
Superfamily HMG-box 0.00000265
Family HMG-box 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000007326   Gene: ENSAMEG00000006918   Transcript: ENSAMET00000007633
Sequence length 5208
Comment pep:known_by_projection scaffold:ailMel1:GL193569.1:99886:130947:1 gene:ENSAMEG00000006918 transcript:ENSAMET00000007633 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSQKPPGEDKDSEPAADGPAASEESGTTEPDLPNPHVGEVSVPSSGGPRLQEPPQDCSG
GPVRRCALCNCGEPSLHGQRELRRFELPFDWPQGPVVSPGGNPGPSEAALPSEDLSQIGF
PEGLTPAHLGEPGGSCWAHHWCAAWSAGVWGQEGPELCGVDKAIFSGISQRCSHCTRLGA
SIPCRSPGCPRLYHFPCATASGSFLSMKTLQLLCPEHSEGAAHLEEARCAVCEGPGELCD
LFFCTSCGHHYHGACLDTALTARKRAGWQCPECKVCQACRKPGNDSKMLVCETCDKGYHT
FCLKPPMEELPAHSWKCKACRVCRACGAGSAELNPNSEWFENYSLCHRCHKAQGGQLVSS
VAEQQPPVCSRFSPPEPGDNPTDEPEALYVACQGQPKGGNVTSMQPKEPGPLQCEAKPLG
RAGAQLEPRLEVPLNEEMPLLPPPEESPLSPPPEESPTSPPPEASRLSPPPEESPLSPPP
EESPLSPPPESSPFSPLEESPFSPPAESPPSPPLETPLSPPPEASPLSPPFEESPLSPPP
EELPTSPPPEASRLSPPPEESPMSPPPEESPMSPPPEASRLFPPFEESPLSPPPEESPLS
PPPEASRLSPPPEDSPMSPPPEDSPMSPPPEVSCLSPLPEVSRLSPPPEESPLSPVAPPA
LSPLGELEYPFGAKGDSDPESPLAAPILETPISPPPEANCTDPEPVPPMILPPSPGSPVG
PASPILMEPLPSRCSPLLQHSLPPQNSPPSQCSLPALPLSIPSPLSPMEKAVEVSDEAEL
HEMETEKVPEPECPALEPSPTSPLPSPMGNLSCPAPSPAPALDDFSGLGEDTAPLDGTDT
PGSQPEAGQTPGSLASELKGSPVLLDPEELAPVTPMEVYGPEGKQAGQGSPCEEQEEPRV
PVAPTPPTLIKSDIVNEISNLSQGDASASFPGSEPLLGSPDPEGGGSLSMELGVSTDVSP
ARDEGSLRLCTDSLPETDDSLLCDAGTAIGGGKAEGDKGRRRSSPARSRIKQGRSSSFPG
RRRPRGGAHGGRGRGRARLKSTTSSIETLVVADIDSSPSKEEEDDDDDTMQNTVVLFSNT
DKFVLMQDMCVVCGSFGRGAEGHLLACSQCSQCYHPYCVNSKITKVMLLKGWRCVECIVC
EVCGQASDPSRLLLCDDCDISYHTYCLDPPLLTVPKGGWKCKWCVSCMQCGAASPGFHCE
WQNSYTHCGPCASLVTCPICHAPYMEEDLLIQCRHCERWMHAGCESLFTEDDVEQAADEG
FDCVSCQPYVVKPAVPVAPPELVPMKVKEPEPQYFRFEGVWLTETGMAVLRNLTMSPLHK
RRQRRGRLGLPGEAGLEGAEPSDALGPDDKKDGDLDTDELLKGEGGVEHMECEMKLEGPV
SPDVEPGREETEESKKRKRKPYRPGIGGFMVRQRKSHTRVKKGPAAQAEVLSGDGQPDEV
MPADLPVEGPVDQSLADGDEKKKQQRRGRKKSKLEDMFPAYLQEAFFGKELLDLSRKALF
AVGVGRPSFGLGTPKAKGDGGSDRKELPTSQKGDDGPDVADEESRGPEGKADTPAIAGPE
DGGVKASPVPSDPEKPGTPGEGMLSSDLDRIPTEELPKMESKDLQQLFKDVLGSEREQHL
GCGTPGPDGSRTPLQRPFLQGGLPLGNLPSSSPMDSYPGLCQSPFLDSRERGGFFSPEPG
EPDSPWTGSGGTTPSTPTTPTTEGEGDGLSYNQRSLQRWEKDEELGQLSTISPVLYANIN
FPSLKQDYPDWSSRCKQIMKLWRKVPAADKAPYLQKAKDNRAAHRINKVQKQAESQINKQ
TKVGDMARKTDRPALHLRIPPQPGALGSPPPAAAPTIFIGSPTTPAGLSTSADGFLKPPA
GTVPGPDSPGELFLKLPPQVPAQVPSQDPFGLAPAYALEPRFPTAPPTYPPYPSPTGAPA
QPLTLGASSRPGTGQPGEFHTTPPGTPRHQPSTPDPFLKPRCPSLDNLAVPESPGVGGGK
ATEPLLSPPPFAESRKALEVKKEELGASSPSYGPPNLGFVDSPSSGPHLGSLELKAPDVF
KAPLTPRASQVEPQSPGLGLRPQEPPPAQALAPSSPSHSDIFRPGPYPDPYAQPPLTPRP
QPPPPESCCALPPRSLPSDPFSRVPASPQSQSSSQSPLTPRPLSAEAFCPSPVTPRFQSP
DPYSRPPSRPQSRDPFAPLHKPPRPQPPEVAFKAGPLAHTPLGAGGFPAALPSGPAGELH
AKVPSGQPPNFARSPGTGAFVGTPSPMRFTFPQAVGEPSLKPPVPQPGLPPPHGINSHFG
PGPTLGKPQSTNYTVATGNFHPSGSPLGSSSGSTGEGFGLSPLRPPSVLPPPAPDGSLPY
LSHGASQRAGITSPADKREDPGAGMGSSLAAPELPGTQDPGMSSLSQTELEKQRQRQRLR
ELLIRQQIQRNTLRQEKETAAAAAGAVGPPGSWGAEPSSPAFEQLSRGQTPFPGTQDKSS
LVGLPPSKLGGPILGPGAFPGDDRLSRPPPPATPSSMDVNNRQLVGGSQAFYQRAPYPGS
LPLQQQQQQPLWQQQQQQQAATAATSMRLAMSTRFPSTPGPELGRQALGSPLAGIPTRLP
GPGEPVPGPAGPAQFIELRHNVQKGLGPGGAPFPGQGPPQRPRFYPVSEDSHRMAPEGLR
GLAVSGLPPQKPSAPPAPELNNSLHPMPHTKGPSLPTGLELVSRPPSSSELGRPPPLALE
TGKLPCEDPELDDDFDAHKALEDDEELAHLGLGVDVAKGDDELGTLENLETNDPHLDDLL
NGDEFDLLAYTDPELDTGDKKDIFNEHLRLVESANEKAEREALLRGVEPVPLGPEERPPP
AADASEPRLASVLPEVKPKVEEGGRHPSPCQFTVTTPKVEPAPATTSLGLGLKPGQSVMG
SRDTRMGTGPFSSSGHTTEKSPFGATGGPPAHLLTPSPLSGPGGSSLLEKFELESEALTL
PGGHAASGDELDKMESSLVASELPLLIEDLLEHEKKELQKKQQLSAQLQPAQQQQQQQQQ
QQHSLLSTPGPAQAMSLPHEGSSPSLAGPQQQLALGLGGSRQPGLAQPLMPTQPPAHALQ
QRLAPSMAMVSNQGHMLSGQHGGQAGLVPQQSSQPVLAQKPVGTVPPSMCMKPQQLAMQQ
QLANSFFPDTDLDKFAAEDIIDPIAKAKMVALKGIKKVMAQGSIGVAPGMNRQQVSLLAQ
RLSGGPGSDLQNHVAAGSGQQERSAGDPSQPRPNPPTFAQGVINEADQRQYEEWLFHTQQ
LLQMQLKVLEEQIGVHRKSRKALCAKQRTAKKAGREFPEADAEKLKLVTEQQSKIQKQLD
QVRKQQKEHTNLMAEYRNKQQQQQQQQQQQQHSAVLALSPSQSPRLLTKLPGQLLPGHGL
QPPQGPPGGQAAGLRLPPGSMTLPGQPGGPFLNTSLAQQQQQQHSGGAGALAGPSGGFFP
GNLALRGLGPDSRLLQERQLQLQQQRMQLAQKLQQQQQQQQHLLGQVAVQQQQQQSLGVQ
ANQALGPKPQALLPPSSHPGLLVQQLSPQPPQGPQGMLGPAQVAVLQQQQQHPGALGPQG
PHRQVLLTQSRVLSSPQLAQQGQGLMGHRLVTAQQQQQQQHQQGSMAGLSHLQQGLMPHG
GQPKLSAQPMAALQQQQQLQQQQQQQLQQQQQQQQQMGLLNQSRTLLSPPQQPPQPSQQQ
VPLGPGMPAKPAQHFSSPGALGATILTGKEQSMVETALPPEAAEGPSIHQGAPLALGAVA
ESAATEPGEVKPSLSGDSQLLLVQPQAQPQPSPVQLQPPLRLPGPQQQQMNLLHTAGVGS
HGQAGSGSSSEASSVPHLLAQSSVPLGEQPGTMTQNLLGSQQPLGLERPVQNNAGPQPAK
AGSVPQSGPGLPGPGIMPTVGQLRAQLQGVLAKNPQLRHLSPQQQQQLQALLMQRQLQQS
QAVRQAPPYQEPGAQPSPLQGLLGRQPQLGGFPGSQTGPLQELGAGLRPQGPPRLPAPQG
ALAAGPVLGPVHPTPPPSSPQEPKRPSSQPPGASPLVPSQLPSEAQLPPTQPGIPKPQGP
SLELPSGRVSPAAAQLADTFFGKGLGPWDPPDNLVEAQKPEQSSLVPGRLEQVNGQAVPE
PPHLSIKQEPREEPCALGAQAVKREANGEPIGAPGTSNHLLLAGPRSEAGHLLLQKLLRA
KNVQLSTGRGPEGLRAEINGHIDSKLAGLEQKLQGTPSNKEDTAARKPVTPKPKRVQKAS
DRLVSSRKKLRKEDGVRASEALLKQLKQELSLLPLTEPTITANFSLFAPFGSGCPVNGQC
QLRGAFGSGALSTGPDYYSQLLTKNNLSNPPTPPSSLPPTPPPSVQQKMVNGVTPSEELG
EHPKDAASARDTEGTLRDASEVKSLDLLAALPTPPHNQTEDVRMESDEDSDSPDSIVPAS
SPESILGEEAPRFPQLGSGRWEQEDRALSPVIPIIPRASIPVFPDTKPYGALDLEAPGKL
PATTWEKGKGSEVSVMLTVSAAAAKNLNGVMVAVAELLSMKIPNSYEVLFPESPARAGIE
PKKGEAEGPGGKEKGLGGKSPEAGPDWLKQFDAVLPGYTLKSQLDILSLLKQESPAPEPP
TQHSYTYNVSNLDVRQLSAPPPEEPSPPPSPLAPSPASPPAEALVELSTEPLAEPPVPSP
LPLASSPESARPKPRARPPEEAEDSRPPRLKKWKGVRWKRLRLLLTIQKGSGRQEDEREV
AEFMEQLGTALRPDKVPRDMRRCCFCHEEGDGATDGPARLLNLDLDLWVHLNCALWSTEV
YETQGGALMNVEVALHRGLLTKCSLCQRTGATSSCNRMRCPSVYHFACAIRAKCMFFKDK
TMLCPMHKIKGPCEQELSSFAVFRRVYIERDEVKQIASIIQRGERLHMFRVGGLVFHAIG
QLLPHQMADFHSATALYPVGYEATRIYWSLRTNNRRCCYRCSIGENNGRPEFIIKVMEQG
LEDLVFADASPQAVWNRIIEPVAAMRKEADMLRLFPEYLKGEELFGLTVHAVLRIAESLP
GVESCQNYLFRYGRHPLMELPLMINPTGCARSEPKILTHYKRPHTLNSTSMSKAYQSTFT
GETNTPYSKQFVHSKSSQYRRLRTEWKNNVYLARSRIQGLGLYAAKDLEKHTMVIEYIGT
IIRNEVANRREKIYEEQNRGIYMFRINNEHVIDATLTGGPARYINHSCAPNCVAEVVTFD
KEDKIIIISSRRIPKGEELTYDYQFDFEDDQHKIPCHCGAWNCRKWMN
Download sequence
Identical sequences G1LK66
ENSAMEP00000007326 ENSAMEP00000007326

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]