SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000007730 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000007730
Domain Number 1 Region: 56-118
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 7.85e-26
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 2 Region: 464-521
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.92e-26
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 3 Region: 520-577
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.1e-24
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 4 Region: 688-745
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.22e-24
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 5 Region: 408-465
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.31e-23
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 6 Region: 576-631
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.12e-22
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 7 Region: 634-689
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.51e-22
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 8 Region: 730-782
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.93e-18
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 9 Region: 355-409
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000032
Family Classic zinc finger, C2H2 0.024
Further Details:      
 
Domain Number 10 Region: 297-354
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000184
Family Classic zinc finger, C2H2 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000007730   Gene: ENSAMEG00000007349   Transcript: ENSAMET00000008052
Sequence length 791
Comment pep:known_by_projection scaffold:ailMel1:GL193551.1:88976:108085:-1 gene:ENSAMEG00000007349 transcript:ENSAMET00000008052 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAINPWASWGVLTDQSWEMAAVDPWASWALCPQDSAWHVEEDSEEEKRATGLLTAQIQE
PVTFKDVAVDFTQEEWGQLDLVQRTLYRDVMLETYGHLLSVGNQIAKPEVISLLEQGEEP
WSVEQAYPQSTCPEWMRNLESKALIPTQSIFEEEQSHSMKLERYIWDDPWFSRLEVLGCK
DQLEMYHMNQSTAMRQMVFMQKQVLSQRGSEFCGLGAEYSQNLNFVPTQRVSQIEHFYKP
DTNGESWRCNSAIMYADKITCGDHGYDKAFHQSIQPIQPERMQTGDNLLKCTDAVKSFNH
ILHFGDHKGMHTGEKLYEYKECHQIFNQSPSFSEHPRLHIGENQYDYKEYENIFYFSSFM
EHQKIGTVEKAYKYNEWEKVFGYDSFLTQHTSTYTSEKPYEYNECGTSFIWSSYLIQHKK
THTGEKPYECDKCGKVFRNRSALTKHERTHTGIKPYECNKCGKAFSWNSHLIVHKRIHTG
EKPYVCNECGKSFNWNSHLIGHQRTHTGEKPFECTECGKSFSWSSHLIAHMRMHTGEKPF
KCDECEKAFRDYSALSKHERTHSGAKPYKCTECGKSFSWSSHLIAHQRTHTGEKPYNCQE
CGKAFRERSALTKHEIIHSGIKPYECNKCGKSCSQMAHLVRHQRTHTGEKPYECNKCGKS
FSQSCHLVAHRRIHTGEKPYKCNQCERSFNCSSHLIAHRRTHTGEKPYRCNECGKAFNES
SSLIVHLRNHTGEKPYKCNHCEKAFCKNSSLIIHQRMHSGEKRFICNDCGKAFSGHSALL
QHQRNHSEEKL
Download sequence
Identical sequences G1LLA8
ENSAMEP00000007730 XP_011232882.1.58354 XP_019663367.1.58354 ENSAMEP00000007730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]