SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000008146 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000008146
Domain Number 1 Region: 882-1173
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 1.06e-87
Family Complement components 0.0000168
Further Details:      
 
Domain Number 2 Region: 1254-1382
Classification Level Classification E-value
Superfamily Alpha-macroglobulin receptor domain 4.05e-31
Family Alpha-macroglobulin receptor domain 0.0013
Further Details:      
 
Domain Number 3 Region: 717-769
Classification Level Classification E-value
Superfamily E set domains 0.00000000154
Family SVA-like 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000008146   Gene: ENSAMEG00000007712   Transcript: ENSAMET00000008486
Sequence length 1420
Comment pep:novel scaffold:ailMel1:GL192488.1:532936:654281:-1 gene:ENSAMEG00000007712 transcript:ENSAMET00000008486 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PRFLVTAPGIVRPGGNVTVGVELLEHSPSQVTVKAELVKMAANLTVSVLEAEGVFEKGSF
KTLTLPSLPLNSADGIYELRVTGRAQDEILFSNSTRLSFETKRMTVFIQTDKSLYKPKQE
VKFRIITLFSDFKPYKTSLNILIKDPKSNLIQQWLSEQSDLGVVSKTFQLSSHPILGDWS
IQVQVNDQMYYQSFQVSEYVLPKFEVTLQTPLYCSLNSRSLNGTVIAKYTYGKPVKGDVT
LTFLPLSFWGMKKNITKNFKINGSTNFSFNDEEMKKVMDFSEGLSEHMYLSSPGPVEILA
TVTESLTGISRNASSNVFFKQHDYIIEFFDYATVLKPSLNFTATVKVTRADGNRLTFEER
RNNVVITVTQKNSSEHWSRWDSRNQDIEAVQIINYTVPQNGIFKIEFPILDDSNELQLKA
SFLNSVSSMAVHGMFKSPSKTYIQLKTREENIKVGSPFELVVSGNKRLKELSYMVVSRGQ
LVAVGKQNSTTFSLTPENSWAPKACIIVYYIDNDGEIINDVLKIPVQLVFKNKIKLFWSK
AHAEPSEKVSLRISVTQPDSTVGIVAVDKSVNLMNVSNDITMENVVHELELYNTGYYLGM
FMNSFAVFQECGLWVLTDANLLKDYIDGVYDSVEFAERFAEETEGYLVDFHDSSSVSNPR
IRKHFPETWIWLDTNMGSRIYQEFEVTVPDSITSWVATAFVISEDLGLGLTSTPVELQAF
QPFFIFLNLPYSVIRGEEFALEVTIFNYLKDATEVKVIIEKNDKFDILMASNEINATGHQ
QTILVPSEDGATVLFPVKPTHLGEIPITVTAISPTASDAVTQRILVKAEGIEKSYSQSIL
LDLTDNKLQTPVKTLSFSFPPNTVSGSERVQITAIGDILGSSINGLASLIRMPYGCGEQN
MINFAPNIYVLDYLTKKRQLTENLKEKALSFMRQGYQRELLYQREDGSFSAFGNDDPSGS
TWLSAFVLRCFLEADPYIDIDQNVLHRTYTWLKGRQKSSGEFWEPGRVIHSELQGGNKSP
VTLTAYIVTSLLGYKKYQPNIDVQESINFLESEFNRGISDNYTLALITYALSSVGSPKAK
EALNMLTWRAEQEGGMQFWASSESKLSESWQPRSLDIEVAAYALLSHFLQYQVSEGIPIM
RWLSRQRNSLGGFVSTQDTIVALKALSEFAALMNTERTNIQVTVMGPSSPTPVKFWIDTQ
NLFLLQTAELAVLQPTAVNISTSGFGFAICQFNVIYNVKDSGSSRRRRSIQDQEAFDLDV
AVRDNKDDTNHLNLNVCTRFVGPARSGMALMEVNLLSGFTVPPDAIPLSETVRKVEHDHG
KVNLYLDSVNETQICVDIPAVRNFKVSNTQDALVSIMDYYEPRRQAVRSYNSEVKLSSCD
LCGDAPGCGPCERGAAASLYHASVLVALCGTLLFSSQHWL
Download sequence
Identical sequences D2H4I3
ENSAMEP00000008146 ENSAMEP00000008146

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]