SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000009309 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000009309
Domain Number 1 Region: 323-456,758-933
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 6.98e-53
Family Diacylglycerol kinase-like 0.013
Further Details:      
 
Domain Number 2 Region: 55-178
Classification Level Classification E-value
Superfamily PH domain-like 1.88e-29
Family Pleckstrin-homology domain (PH domain) 0.0037
Further Details:      
 
Domain Number 3 Region: 1137-1203
Classification Level Classification E-value
Superfamily SAM/Pointed domain 6.14e-20
Family SAM (sterile alpha motif) domain 0.0031
Further Details:      
 
Domain Number 4 Region: 224-293
Classification Level Classification E-value
Superfamily Cysteine-rich domain 4.04e-17
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0000451
Further Details:      
 
Domain Number 5 Region: 164-220
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000389
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000009309   Gene: ENSAMEG00000008800   Transcript: ENSAMET00000009708
Sequence length 1211
Comment pep:known_by_projection scaffold:ailMel1:GL192447.1:2025028:2174137:1 gene:ENSAMEG00000008800 transcript:ENSAMET00000009708 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PAGAAGGAEDGGCGRXXXXXXXXXXGDDSSDSEAEQEGPQKLIRKVSTSGQIRTKTSIKE
GQLLKQTSSFQRWKKRYFKLRGRTLYYAKDSKSLIFDEVDLSDASVAEASTKNANNSFTI
ITPFRRLMLCAENRKEMEDWMSSLKSVQTREPYEVAQFNVEHFSGMHNWYACSHARPTFC
NVCRESLSGVTSHGLSCEVCKFKAHKRCAVRATNNCKWTTLASIGKDIIEDEDGVAMPHQ
WLEGNLPVSAKCAVCDKTCGSVLRLQDWKCLWCKTMVHTACKDLYHPVCPLGQCKVSIIP
PIALNSTDSDGFCRATFSFCVSPLLVFVNSKSGDNQGVKFLRRFKQLLNPAQVFDLMNGG
PHLGLRLFQKFDNFRILVCGGDGSVGWVLSEIDKLNLNKQCQLGVLPLGTGNDLARVLGW
GGSYDDDTQLPQILEKLERASTKMLDRWSIMTYELKLPPKASLLPEPPEASEEFYMTIYE
DSVAAHLTKILNSDEHAVVISSAKILCETVKDFVAKVEKAYEKTLENAVAADAVASKCSV
LNEKLEQLLQALHADSQAAPVLPGIRSLIVEEDTAESSSEESLCESKEQLADDPAKPPSQ
KAVKPKEIMLRANSLKKAVRQVIEEAGKVMDDQSVHPCEPVNQSFDNDSTETDESKEESK
DDDATASLTVKTAPAPRSPDGRANRSQTDSGPGPAVAASKENLPVLNTRIICPGLRAGLA
ASIAGSSIINKMLLANIDPFGATPFIDPDPDSVDGYSEKCVMNNYFGIGLDAKISLEFNN
KREEHPEKCRSRTKNLMWYGVLGTRELLQRSYKNLEQRVQLECDGQYIPLPSLQGIAVLN
IPSYAGGTNFWGGTKEDDIFAAPSFDDKILEVVAIFDSMQMAVSRVIKLQHHRIAQCRTV
KITIFGDEGVPVQVDGEAWVQPPGIIKIVHKNRAQMLTRDRAFESTLKSWEDKQKCDSGK
PVLRTHLYIQHAVDLATEEVSQMQLCSQAAEELITRICDAATIHCLLEQELAHAVNACSH
ALNKANPRFPESLTRDTATEIAINVKALYNETESLLVGRVPLQLESPHEERVSDALHCVE
VELQKLTEIPWLYYILHPNEDEEPPMDCTKRNSRSTVFRIVPKFKKEKVQKQKTSSQPVQ
KWGTEEVAAWLDLLNLGEYKEIFIRHDIRGAELLHLERRDLKDLGITKVGHMKRILQGIK
ELGRSTPQSEV
Download sequence
Identical sequences G1LQH7
ENSAMEP00000009309 ENSAMEP00000009309

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]