SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000011599 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000011599
Domain Number 1 Region: 249-519
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.5e-79
Family Protein kinases, catalytic subunit 0.00000000121
Further Details:      
 
Domain Number 2 Region: 111-238
Classification Level Classification E-value
Superfamily SH2 domain 6.56e-39
Family SH2 domain 0.00000651
Further Details:      
 
Domain Number 3 Region: 71-115
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000129
Family SH3-domain 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000011599   Gene: ENSAMEG00000010994   Transcript: ENSAMET00000012092
Sequence length 526
Comment pep:novel scaffold:ailMel1:GL192357.1:3354980:3364411:-1 gene:ENSAMEG00000010994 transcript:ENSAMET00000012092 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGCVFCKKSEPALKEDVGLERDFRGGGAADRYGPDPTRARTVSSFAHIPNYNFPTQSTTP
AFLDGGTIRAISGTGVTLFIALYDYEARTEDDLTFTKGEKFHILNNTEGDWWEARSLSSG
QTGYIPSNYVAPVDSIQAEEWYFGKIGRKDAERQLLSPGNPRGAFLIRESETTKGAYSLS
IRDWDQARGDHVKHYKIRKLDTGGYYITTRAQFDSVQELVQHYIEVNDGLCHLLTAACTT
MKPQTMGLAKDAWEISRSSIALERRLGTGCFGDVWLGMWNGSTKVAVKTLKPGTMSPKAF
LAEAQIMKMLRHDKLVQLYAVVSEEPIYIVTEFMCHGSLLEFLKDRQGQDLTLPQLVDMA
AQVAEGMAYMERMNYIHRDLRAANILVGERLVCKIADFGLARLIEDDEYNPQQGAKFPIK
WTAPEAALFGRFTIKSDVWSFGILLTELISKGRVPYPGMNNREVLEQVEHGYHMPCPPGC
PVSLYEAMEQTWRLDPEERPTFEYLQSFLEDYFTSTEPQYQPGDQT
Download sequence
Identical sequences D2GWJ1
ENSAMEP00000011599 ENSAMEP00000011599 XP_002913367.1.58354 XP_011227310.1.58354

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]