SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000011789 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000011789
Domain Number 1 Region: 773-954
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 8.37e-44
Family Ypt/Rab-GAP domain of gyp1p 0.005
Further Details:      
 
Domain Number 2 Region: 929-1048
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 4.18e-32
Family Ypt/Rab-GAP domain of gyp1p 0.0045
Further Details:      
 
Domain Number 3 Region: 157-192,231-377
Classification Level Classification E-value
Superfamily PH domain-like 1.35e-30
Family Phosphotyrosine-binding domain (PTB) 0.0066
Further Details:      
 
Domain Number 4 Region: 14-157
Classification Level Classification E-value
Superfamily PH domain-like 8.47e-19
Family Phosphotyrosine-binding domain (PTB) 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000011789   Gene: ENSAMEG00000011195   Transcript: ENSAMET00000012287
Sequence length 1160
Comment pep:known_by_projection scaffold:ailMel1:GL193334.1:192625:407794:-1 gene:ENSAMEG00000011195 transcript:ENSAMET00000012287 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPITFTARKHPFPNEASVDFSLQLVGLLRVHALTTMPMLPWVVAEVRRLNGQASKKEPG
ARQVRLCVSPSGLRCEPEPGKSQQWDPLICSSIFECKPQHVHKLIHNSHDPSYFACLIKD
SAASQQSICYVFKAYDQTKVPEIISSIRQAGKIARQEELHCPSEFDDTFAKKFEVLFCGR
VTVAHKKAPPALIDECIEKFSHVSCSRKAEFDLASQNSETPVGNGEQGRRPMRKSFSQPG
LRSLAFTKEFQDGSLRSSRFFSSFEENDTENHLISGHNIVQPTDSEENRTMLFTIGQSEV
YLISPDTKKIALEKNFKEISFCSQGIRHVDHFGFICRESAGGGGFHFVCYVFQCASEALV
DEIMMTLKQAFTVAAVQHTAKAPAQLCEGCPLQGLHKLCERIEGMNSSKTKLELQKHLTT
LTNQEQATIFEEVQKSRPRSEQRENELIISFLRCLYEEKQKGHIHIGDLKQTSQMAAENI
GSELLPSATRFRLDMLKNKAKRSLTESLESILSRGSKARGLQEHSASLDLDSSMSSTLSN
TSKEPSVCDKEALPASESSFRLLGSSDDLSSDSESHPAEEPAPLSPRQSFRRRANTLSHF
PVECQESPEPAQGSPGVSQRKLMRYHSVSTETPHDRKDFDSKANHLGDASRTPVKTRRHS
WRQQIFLRVATPQKACDAPSRYEDYSELGELPPRSPLEPVCEDGPFGSVPEEKKRTSREL
RELWQKAILQQILLLRMEKENQKLQASENDLLNKRLKLDYEEITPCLKEVTTVWEKMLST
PGRSKIKFDMEKVHLAVGQGVPRHLRGEIWKFLAEQYRLQHQFPSKQQPKDTPYKELLKR
LTSQQHAILIDLGRTFPTHPYFSAQLGAGQLSLYNILKAYSLLDQEVGYCQGLSFVAGIL
LLHMGEEEAFNMLKFLMFEMGLRKQYRPDMIILQIQMYQLSRLLHDYHRDLYNHLEEHEI
GPSLYAAPWFLTVFASQFPLGFVARVFDMIFLQGSEVIFKVALSLLGSHKPLILQHENLE
TIVDFIKNTLPNLGLVQMEKTISQVFEMDIAKQLQAYEVEYHVLQEELIDSSPLSDNQRM
DKLEKTNSSLRKQNLDLLEQLQVANGRIQSLEATVEKLLTSESKLKQASLALELERSALL
QTVQELRMQMMAAPRGPEPD
Download sequence
Identical sequences G1LXI4
ENSAMEP00000011789 ENSAMEP00000011789

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]