SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000011981 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000011981
Domain Number 1 Region: 890-1071
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 9.42e-40
Family Ypt/Rab-GAP domain of gyp1p 0.0058
Further Details:      
 
Domain Number 2 Region: 1046-1167
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 3.92e-33
Family Ypt/Rab-GAP domain of gyp1p 0.0039
Further Details:      
 
Domain Number 3 Region: 188-218,311-440
Classification Level Classification E-value
Superfamily PH domain-like 9.74e-29
Family Phosphotyrosine-binding domain (PTB) 0.005
Further Details:      
 
Domain Number 4 Region: 31-182
Classification Level Classification E-value
Superfamily PH domain-like 3.01e-19
Family Phosphotyrosine-binding domain (PTB) 0.009
Further Details:      
 
Weak hits

Sequence:  ENSAMEP00000011981
Domain Number - Region: 1171-1254
Classification Level Classification E-value
Superfamily Tropomyosin 0.0418
Family Tropomyosin 0.0094
Further Details:      
 
Domain Number - Region: 435-496
Classification Level Classification E-value
Superfamily Recombination protein RecR 0.0641
Family Recombination protein RecR 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000011981   Gene: ENSAMEG00000011360   Transcript: ENSAMET00000012487
Sequence length 1297
Comment pep:known_by_projection scaffold:ailMel1:GL193516.1:67139:250075:-1 gene:ENSAMEG00000011360 transcript:ENSAMET00000012487 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPPSCIQNEPFPHPLEPEPGAPAQPGPGKPGDKRFRLWYVGGSCLDRRTTLPMLPWLMA
DRRSQKPEAGGCGAPAAREVLLVLSAPFLRCVPAPGVGASGGVPRAAQPNPAVFIFEHKA
QHISRFIHNSHDLTYFAYLIKAQPDDPESQMACHVFRATDPNQVPDVISSIRQLSKAAMK
EDAKASKDNEDAFYNSQKFEVLYCGKVTVTHKKAPSSLIDDCIEKFSLHEQQRLKIQGEQ
RGADAGDDPVVIEAVAPGPATDILSEEGDGVPNAQPALPPAASQPGLPSSRAGFPERILE
DSGFDEQQEFRSRCSSVTGVMQRKVHENSQKPLPRRRHASAPSHVQPSDSEKNRTMLFQV
GRFEINLISPDTKSVVLEKNFKDISSCSQGIKHVDHFGFICRESAEPGLSQYICYVFQCA
SESLVDEVMLTLKQAFSTAAALQSAKTQIKLCEACPMHSLHKLCERIEGLYPPRAKLVIQ
RHLSSLTDNEQADIFERVQKMKPVSDQEENELVILHLRQLCEAKQKTHIHIGEGPSTISN
STIPENATSSGRFKLDILKNKAKRSLTSSLENIFSRGANRMRGRLGSMDSFERSNSLASE
KDYSPGDSPPGTPPASPLSSAWQTFPEEDSDSPQFRRRAHTFSHPPSSTKRKLNLQDGRA
HGVRSPLLRQSSSEQCSILPSVRRMHKESNSSSSLPSLHTSFSAPSFTAPSFLKSFYQNS
GRLSPQYENEIRQDTASESSDGEGRKRTSSTCSNESLNAGGTPVTPRRISWRQRIFLRVA
SPMNKSPSAMQQADGLDRNELLPLSPLAPTMEEEPLVIFMSGEDDPEKAEERKKSEELRS
LWKKAIHQQILLLRMEKENQKLEASRDELQSRKVKLDYEEVGVCQKEILITWDKKLLNCR
AKIRCDMEDIHISLKEGVPKSRRGEIWQFLALQYRLRHRLPNKQPPPDISYKELLKQLTA
QQHAILVDLGRTFPTHPYFSAQLGAGQLSLFNLLKAYSLLDKEVGYCQGISFVAGVLLLH
MSEEQAFEMLKFLMYDQGFRKQYRPDMMSLQIQMYQLSRLLHDYHRDLYNHLEENEISPS
LYAAPWFLTLFASQFPLGFVARVFDIIFLQGTEVIFKVALSLLSSQETLIMECENFESIV
EFLKTTLPDMNISEMEKIITQVFEMDISKQLHAYEVEYHVLQDELQESSYACEDTEPMEK
LERANSQLKRQNMDLLEKLQIAHAKIQTLESNLENLLTRETKMKSLIRTLEQEKMAYQKT
VDQIRKLLPADALANCESLLRDLNCNPNNKAKTGNKP
Download sequence
Identical sequences G1LY25
ENSAMEP00000011981 ENSAMEP00000011981

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]