SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000012256 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000012256
Domain Number 1 Region: 439-685
Classification Level Classification E-value
Superfamily vWA-like 1.7e-70
Family Trunk domain of Sec23/24 0.00013
Further Details:      
 
Domain Number 2 Region: 188-456
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 5.23e-37
Family beta-sandwich domain of Sec23/24 0.0042
Further Details:      
 
Domain Number 3 Region: 687-782
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 1.01e-36
Family beta-sandwich domain of Sec23/24 0.0014
Further Details:      
 
Domain Number 4 Region: 889-1030
Classification Level Classification E-value
Superfamily C-terminal, gelsolin-like domain of Sec23/24 6.54e-32
Family C-terminal, gelsolin-like domain of Sec23/24 0.0017
Further Details:      
 
Domain Number 5 Region: 783-888
Classification Level Classification E-value
Superfamily Helical domain of Sec23/24 5.1e-29
Family Helical domain of Sec23/24 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000012256   Gene: ENSAMEG00000011604   Transcript: ENSAMET00000012775
Sequence length 1034
Comment pep:known_by_projection scaffold:ailMel1:GL192600.1:1618441:1713914:-1 gene:ENSAMEG00000011604 transcript:ENSAMET00000012775 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQQGYVATPPYSQSQPGIGLSPPHYGHYGDPSHAGSPPGMMKPAGPLGAAAPGGMLPQG
PSPPGPHQFGQNGAHAQGHPPQRFPGPPPVNSAVSSYAPYSPSTPSSYPSPASTSSVAQL
GHQLSAMHVNSYGSGMAPPGQGPPGSPSAPLFQGPPHPPQPSIMQPGSQVLPPPPTTALN
GPGASPLPPSTHRQDGLPGPAPLNAQYQPPLLPGQTLGTGYLPQQAANYGPQMAGGQLSY
PGGFPGGPAQMAGPPQLQKKLDPDSIPSPIQVIENDRATRGGQVYATNTRGQVPPLVTTD
CVIQDQGNASPRYIRCTTYCFPCTSDMAKQAQIPLAAVIKPFATIPSNETPLYLVNHGEN
GPVRCNRCKAYMCPFMQFIEGGRRYQCGFCNCVNDVPPFYFQHLDHIGRRLDHYEKPELS
LGSYEYVATLDYCRKNKPPSPPAFIFMIDVSYSNIKNGLVKLICEELKTVLEKLPKEEQE
ETSAIRVGFITYNKVLHFFNVKSNLAQPQMMVVTDVGEVFVPLLDGFLVNYQDSQSVIHN
LLDQIPEMFADSNENETVFAPVIQAGMEALKAADCPGKLFIFHSSLPTAEAPGKLKNRDD
KKLINTDKEKILFQPQTNVYDSLAKDCVAHGCCVTLFLFPSQYVDVASLGLVPQLTGGTL
YKYNNFQMHMDSQQFLNDLRNDIEKKIGFDAIMRVRTSTGFRATDFFGGIFMNNTTDVEM
AAIDCDKAVTVEFKHDDKLGEDSGALIQCAVLYTTIGGQRRLRIHNLSLNCSSQLADLYK
SCETDALINFFAKSAFKAVLHQPLKVIREILVNQTAHMLACYRKNCASPSAASQLILPDS
MKVLPVYMNCLLKNCVLLSRPEISTDERAYQRQLVMTMGVADSQLFFYPQLLPIHTLDVK
STTLPAAIRCSESRLSEEGIFLLANGLNMFLWLGVSSPPELIQGIFNVPSFAHVSTDMTL
LPEVGNPYSQTLRMIMSIIQQKRPYSMKLTIVKQREQPEMVFRQFLVEDKGLYGGSSYVD
FLCCVHKEICQLLN
Download sequence
Identical sequences G1LYU9
ENSAMEP00000012256 ENSAMEP00000012256

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]