SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000012324 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000012324
Domain Number 1 Region: 601-904
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.13e-82
Family Protein kinases, catalytic subunit 0.000000000176
Further Details:      
 
Domain Number 2 Region: 33-203
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.02e-65
Family Ephrin receptor ligand binding domain 0.00000998
Further Details:      
 
Domain Number 3 Region: 324-524
Classification Level Classification E-value
Superfamily Fibronectin type III 5.03e-30
Family Fibronectin type III 0.0016
Further Details:      
 
Domain Number 4 Region: 892-962
Classification Level Classification E-value
Superfamily SAM/Pointed domain 2.01e-18
Family SAM (sterile alpha motif) domain 0.001
Further Details:      
 
Weak hits

Sequence:  ENSAMEP00000012324
Domain Number - Region: 260-326,362-377
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00022
Family Growth factor receptor domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000012324   Gene: ENSAMEG00000011607   Transcript: ENSAMET00000012853
Sequence length 971
Comment pep:known_by_projection scaffold:ailMel1:GL192825.1:164314:187046:1 gene:ENSAMEG00000011607 transcript:ENSAMET00000012853 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RMCYVARVGWGCFMLRGGCGRSRHECPRGPHAFVLLDFAAAKGELGWLTHPYGKGWDLMQ
NIMDDMPIYMYSVCNVVAGDQDNWLRTNWVYRGEAERIFIELKFTVRDCNSFPGGASSCK
ETFNLYYAESDVDYGTNFQKRQFTKIDTIAPDEITVSSDFETRHVKLNVEERSVGPLRRK
GFYLAFQDIGACVALLSVRVYYKKCPELLQGLARFPETIAGSDAPSLATVAGTCVEHAVV
PPGGEEPRMHCAVDGEWLVPIGQWVEDACQACSPGFFKSEASESPCLECPVHTVLAPEGA
TFCECEEGYFRAPQDLLSMPCTRPPSAPHYLTAVGMGAKVELRWTPPQDSGGRDDIVYSV
TCEQCWPESGECGPCEASVRYSEPPHALTRTSVTVSDLEPHMNYTFAVEARNGVSGLVAS
RSFRTASVSINQTEPPKVKLEGRSTTSLSVSWSIPPPQQSRVWKYEVTYRKKGDSNSYNV
RRTEGFSVTLDDLAPDTIYLVQVQALTQEGQGAGSKIHEFQTLSTEGSGNMAVIGSVAVG
VVLLLVLAGIGIFIHRRRKSLRTRQSSEDVYFSKSEQLKPLKTYVDPHTYEDPNQAVLKF
TTEIHPSCVTRQKVIGAGEFGEVYKGTLKASGKKEVPVAIKTLKAGYTEKQRVDFLSEAS
IMGQFSHHNIIRLEGVVSKYKPMMIITEYMENGALDKFLREKDGEFSVLQLVGMLRGIAA
GMKYLANMNYVHRDLAARNILVNSNLVCKVSDFGLSRVLEDDPEATYTTSGGKIPIRWTA
PEAISYRKFTSASDVWSYGIVMWEVMTYGERPYWELSNHEVMKAINDGFRLPTPMDCPSA
IYQLMMQCWQQERIRRPKFADIVSILDKLIRAPDSLKTLADFDPRVSIRLPSTSGSEGVP
FRTVSEWLESIKMQQYTEHFLAAGYTVIEKVVQMTNDDIKRIGVRLPGHQKRIAYSLLGL
KDQVNTVGIPI
Download sequence
Identical sequences G1LZ16
ENSAMEP00000012324 ENSAMEP00000012324

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]