SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000012625 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000012625
Domain Number 1 Region: 344-401
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.26e-23
Family Classic zinc finger, C2H2 0.0093
Further Details:      
 
Domain Number 2 Region: 428-485
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.12e-21
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 3 Region: 176-233
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.24e-20
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 4 Region: 260-317
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.31e-20
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 5 Region: 2-56
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.57e-19
Family KRAB domain (Kruppel-associated box) 0.00074
Further Details:      
 
Domain Number 6 Region: 472-532
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.08e-19
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 7 Region: 540-597
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.48e-16
Family Classic zinc finger, C2H2 0.0097
Further Details:      
 
Domain Number 8 Region: 138-190
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000197
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 9 Region: 586-638
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000204
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 10 Region: 83-135
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000065
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 11 Region: 307-339
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000213
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 12 Region: 391-422
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000254
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 13 Region: 223-254
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000865
Family Classic zinc finger, C2H2 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000012625   Gene: ENSAMEG00000012002   Transcript: ENSAMET00000013160
Sequence length 641
Comment pep:known_by_projection scaffold:ailMel1:GL192799.1:3175:35749:-1 gene:ENSAMEG00000012002 transcript:ENSAMET00000013160 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DSVAFEDVTVKFTMEEWALLDPSQKKLYRDVMQETFRNLASIEEKWEIHDREDQDENHGA
NLSSQMVERLCKSKEYSQYEEIFSQIPYHNQKKKSPTGIKLRKCTLCGQVFMYHSSFNKH
MRSHTGHKPYEYQEYEEKPYKCMECGKSFKHRQSTRMHERTHTGQRPYECKHCGKAFICR
NYFQIHERAHSGEKPYKCTKCGKTFSYSSNLRKHERTHIGEKPSECKQCGKAFSCLRSFR
IHERIHSAKKPKECTKCGKTFSYSSNLHKHERSHNGEKPYECKECGKAFRCPKNCRSHEM
THSGVKPYECKECGKAFSSPRSLGKHRRIHTARKPHECKECGKAFRYPSSLRNHERTHTG
EKPYKCKECGKAFSCPNYFRIHERAHTGVKPYECKQCGKAFSCPQSFRIHEKTHSAEKPY
ECIKCGKVFRYSSNLRKHERSHTDDKRYECKLCGKAFSSHYYVQKHERTHTGEKPYECKE
CGKGFIFRSGVRSHMVIHTGDGPYKCKKCKKAFISPSSLQAHERTHTGEKPYQCKTCCKA
FSLINSLRNHERTHIKERLHKCKKCGKSFKHRQSTRMHERTHTGQRPYECKHRGKAFMCR
NYIQIHERAHSGEKPYKCKQCGKAFSCLRFFQIHERKHRAK
Download sequence
Identical sequences G1LZW5
ENSAMEP00000012625 ENSAMEP00000012625

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]