SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000012628 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000012628
Domain Number 1 Region: 371-428
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.52e-23
Family Classic zinc finger, C2H2 0.0093
Further Details:      
 
Domain Number 2 Region: 455-512
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.51e-21
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 3 Region: 175-232
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.23e-20
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 4 Region: 499-559
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.07e-19
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 5 Region: 2-43
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.31e-18
Family KRAB domain (Kruppel-associated box) 0.00091
Further Details:      
 
Domain Number 6 Region: 231-286
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.05e-17
Family Classic zinc finger, C2H2 0.0093
Further Details:      
 
Domain Number 7 Region: 306-357
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.86e-16
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 8 Region: 137-189
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000182
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 9 Region: 549-583
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000104
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 10 Region: 82-134
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000608
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 11 Region: 418-449
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000248
Family Classic zinc finger, C2H2 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000012628   Gene: ENSAMEG00000012002   Transcript: ENSAMET00000013163
Sequence length 597
Comment pep:known_by_projection scaffold:ailMel1:GL192799.1:33357:35749:-1 gene:ENSAMEG00000012002 transcript:ENSAMET00000013163 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DSVAFEDVTVKFTMEEWALLDPSQKKLYRDVMQETFRNLASIGRDDDILTCSINDVVLIF
YSSQMVERLCKSKEYSQYEEIFSQIPYHNQKKKSPTGIKLRKCTLCGQVFMYHSSFNKHM
RSHTGHKPYEYQEYEEKPYKCMECGKSFKHRQSTRMHERTHTGQRPYECKHCGKAFICRN
YFQIHERAHSGEKPYKCTKCGKTFSYSSNLRKHERTHIGEKPSECKQCGKAFSCLRSFRI
HERIHSAKKPKECTKCGKTFSYSSNLHKHERSHNGEKPYECKEGGKALHSLTKFQRYVIK
QNGDGIYKCKECGKAFRCPKNCRSHEMTHSGVKPYECKECGKAFSSPRSLGKHRRIHTAR
KPHECKECGKAFRYPSSLRNHERTHTGEKPYKCKECGKAFSCPNYFRIHERAHTGVKPYE
CKQCGKAFSCPQSFRIHEKTHSAEKPYECIKCGKVFRYSSNLRKHERSHTDDKRYECKLC
GKAFSSHYYVQKHERTHTGEKPYECKECGKGFIFRSGVRSHMVIHTGDGPYKCKKCKKAF
ISPSSLQAHERTHTGEKPYQCKTCCKAFSLINSLRNHERTHMEKVCENKECKKAVIC
Download sequence
Identical sequences G1LZW8
ENSAMEP00000012628

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]