SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000013193 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000013193
Domain Number 1 Region: 178-301
Classification Level Classification E-value
Superfamily Dystroglycan, domain 2 2.88e-59
Family Dystroglycan, domain 2 0.000000376
Further Details:      
 
Domain Number 2 Region: 494-595
Classification Level Classification E-value
Superfamily Cadherin-like 6.75e-19
Family Dystroglycan, N-terminal domain 0.014
Further Details:      
 
Domain Number 3 Region: 59-157
Classification Level Classification E-value
Superfamily Cadherin-like 1.46e-18
Family Dystroglycan, N-terminal domain 0.00000255
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000013193   Gene: ENSAMEG00000012540   Transcript: ENSAMET00000013748
Sequence length 892
Comment pep:novel scaffold:ailMel1:GL192765.1:968256:984436:-1 gene:ENSAMEG00000012540 transcript:ENSAMET00000013748 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRMSAGLSLLLPIWGRTFLLLLSVAVAQSHWPLEAGRDWENQLEASMHSVLSDLHEAVPT
VVGIPDGTAVVGRSFRVTIPTDLIASSGELIKVSAAGKEALPSWLHWDPQSHTLEGLPLD
TDKGVHYISVSAMRLGANGSHVPQTSSVFSIEVYPEDHSEPQSVRAASPDPAEVLSSACA
ADEPVTVLTVILDADLTKMTPKQRIELLHRMRSFSEVELPNMKLVPVVNNRLFDMSAFMA
GPGNAKKVVENGALLSWKLGCSLNQNNVPDIRGVEAPAREGAMSAQLGYPVVGWHIANKK
PPLPKRIRRQIHATPTPVTAIGPPTTAIQEPPSRIVPTPTSPAIAPPTETMAPPVRDPVP
GKPTVTIRTRGAIIQTPTLGPIQPTRVSEAGTTVPGQIRPTMTIPGYVEPTAVATPPTTT
TKKPRVSTPKPATPSTDSSTTTTRRPTKKPRTPRPVPRVTTKAPITRLETASPPTRIRTT
TSGIPRGGEPNQRPELKNHIDRVDAWVGTYFEVKIPSDTFYDNEDTTTDKLKLTLKLREQ
QLVGEKSWVQFNSNSQLMYGLPDSSHVGKHEYFMHATDKGGLSAVDAFEIHVHKRPQGDR
APARFKAKFVGDPAPVVNDIHKKITLVKKLAFAFGDRNCSTITLQNITRGSIVVEWTNNT
LPLEPCPKEQIAGLSRRIAEDDGKPRAAFSNALEPDFKATSIVVTGSGSCRHLQFIPTAP
PRRLPSEAPPTDVPDRDPEKSSEDDVYLHTVIPAVVVAAILLIAGIIAMICYRKKRKGKL
TLEDQATFIKKGVPIIFADELDDSKPPPSSSMPLILQEEKAPLPPPEYPNQSVPETTPLN
QDTVGEYTPLRDEDPNAPPYQPPPPFTAPMEGKGSRPKNMTPYRSPPPYVPP
Download sequence
Identical sequences D2HEU8
ENSAMEP00000013193 XP_002920587.1.58354 XP_011224941.1.58354 XP_019656623.1.58354 ENSAMEP00000013193

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]