SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000013241 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000013241
Domain Number 1 Region: 28-150
Classification Level Classification E-value
Superfamily Hormone receptor domain 3.79e-27
Family Hormone receptor domain 0.00035
Further Details:      
 
Domain Number 2 Region: 153-413
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0000000000833
Family Rhodopsin-like 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000013241   Gene: ENSAMEG00000012541   Transcript: ENSAMET00000013798
Sequence length 460
Comment pep:known_by_projection scaffold:ailMel1:GL193304.1:749356:770219:-1 gene:ENSAMEG00000012541 transcript:ENSAMET00000013798 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QGPRTPNPGWRVAQSRGPALGPMSGQATNLQWEEECYHLRMIEVQRKRCLEEAQLENDTA
GCSKMWDNLTCWPATPPGQVVVLACPLIFNLLSPTQGRNVSRSCTSEGWMDLEPGPYPVA
CGWDDKASDLDQQQRSMFYSSVKTGYTIGHSLSLAALLVATAILSLFRKLHCTRNYIHMH
LFISFILRAASVFIKDLTLFDSEESDHCTKGSVSCKAAMVLFQYCVMANFFWLLVEGLYL
HTLLAVSFFSERKYFWGYILIGWALTGVPSTFTVVWAIIMIHFEDYGCWDTINSSLWWII
QAHLDLIHQVNFILFIRIIRILVQKLRSPDVGKSDSSPYSRLAKSTLLLIPLFGAHYFMF
AFFPHNFKAEVKMVFELVVGSFQGFVVAILYCFLNGEVQAELRRKWRRWHLKGILGSKLK
YHHPSGGSNGATCSTQVSMLTRVSPGARRSSSFQAEVLWL
Download sequence
Identical sequences G1M1N0
ENSAMEP00000013241 ENSAMEP00000013241

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]