SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000013700 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000013700
Domain Number 1 Region: 3-118
Classification Level Classification E-value
Superfamily Rap30/74 interaction domains 5.23e-40
Family Rap30/74 interaction domains 0.000000568
Further Details:      
 
Domain Number 2 Region: 175-242
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.8e-24
Family DNA-binding domain from rap30 0.0000294
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000013700   Gene: ENSAMEG00000013015   Transcript: ENSAMET00000014271
Sequence length 249
Comment pep:known_by_projection scaffold:ailMel1:GL192408.1:1204529:1345143:1 gene:ENSAMEG00000013015 transcript:ENSAMET00000014271 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAERGELDLTGAKQNTGVWLVKVPKYLSQQWAKAPGRGEVGKLRIAKNQGRTEVSFTLNE
DLANIHDIGGKPASVSTPREHPFVLQSVGGQTLTVFTESSSDKLSLEGIVVQRAECRPAA
SENYMRLKRLQIEESSKPVRLSQQLDKVVTTNYKPVANHQYNIEYERKKKEDGKRARADK
QHVLDMLFSAFEKHQYYNLKDLVDITKQPVGYLKEILKEIGVQNVKGTHKNTWELKPEYR
HYQGEEKSD
Download sequence
Identical sequences G1M2Y9
ENSAMEP00000013700 XP_002915010.1.58354 XP_003980453.1.62641 XP_004408628.1.74151 XP_007085443.1.5354 XP_008705051.1.72690 XP_014924408.1.86478 XP_019303061.1.44245 XP_021553538.1.83697 XP_851466.2.84170 ENSFCAP00000001947 ENSAMEP00000013700

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]