SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000014252 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000014252
Domain Number 1 Region: 228-497
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.15e-80
Family Protein kinases, catalytic subunit 0.000000000176
Further Details:      
 
Domain Number 2 Region: 118-260
Classification Level Classification E-value
Superfamily SH2 domain 3.27e-37
Family SH2 domain 0.00000296
Further Details:      
 
Domain Number 3 Region: 60-142
Classification Level Classification E-value
Superfamily SH3-domain 2e-22
Family SH3-domain 0.0000363
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000014252   Gene: ENSAMEG00000013465   Transcript: ENSAMET00000014851
Sequence length 505
Comment pep:novel scaffold:ailMel1:GL192588.1:1231475:1254101:-1 gene:ENSAMEG00000013465 transcript:ENSAMET00000014851 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RMGCMKSKFLQDRGKVSKTEPSTNPHSPVYVPDPTSTSKRRPDNGNNIPPGSTDAGPDDI
IVIALYDYEAIHHEDLSFQKGDQMVVLEESGEWWKARSLATRKEGYIPSNYVARVNSLET
EEWFFKGISRKDAERQLLAPGNVLGSFMIRDSETTKGSYSLSVRDYDPQLRDAVKHYKIR
TLDSGGFYVSPRSTFGTLQELVAHYKKGSDGLCQKLTVPCVSSKPQKPWEKDAWEIPRES
LKLEKKLGAGQFGEVWMATYNKHTKVAVKTMKPGSMSVEAFLAEANLMKTLQHDKLVKLH
AVVTEEPIYIITEFMAKGSLLDFLKSPEGSKQPLPKLIDFSAQIAEGMAFIEQRNYIHRD
LRAANILVSASLVCKIADFGLARVIEDNEYTAREGAKFPIKWTAPEAINFGSFTIKSDVW
SFGILLMEIVTYGRIPYPGMTNPEVIRALERGYRMPRPEHCPEELYNIMTRCWKNRPEER
PTFEYIQSVLDDFYTATESQYQQQP
Download sequence
Identical sequences D2H906
ENSAMEP00000014252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]