SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000014643 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000014643
Domain Number 1 Region: 15-218
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.23e-53
Family SPRY domain 0.00000000699
Further Details:      
 
Domain Number 2 Region: 223-262
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000144
Family SOCS box-like 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000014643   Gene: ENSAMEG00000013891   Transcript: ENSAMET00000015250
Sequence length 263
Comment pep:novel scaffold:ailMel1:GL192900.1:606812:608542:1 gene:ENSAMEG00000013891 transcript:ENSAMET00000015250 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGQTALAGGSSSTPTPQTLYPDLSCPEGLEELLSAPRPDLGAQQRHGWNPKDCSENIEVK
EGGLCFERRPVAQSTDGARGKKGYSRGLHAWEISWPREQRGTHAVVGVATALAPLQADHY
AALLGSNSESWGWDIGRGKLYHQSKGPGAPQYPARPHGEQLEVPERLLVVLDMEEGTLGY
AIGGTYLGPAFRGLKGRTLYPAVSAVWGQCQVRISYLGGRRAEPHSLLHLSRLRVRHALG
DTRLGQVSALPLPPAMKRYLLYQ
Download sequence
Identical sequences D2HJ04
XP_002922274.1.58354 XP_008681753.1.72690 ENSAMEP00000014643 ENSAMEP00000014643

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]