SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000014645 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000014645
Domain Number 1 Region: 7-229
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 7.18e-23
Family Nuclease 0.026
Further Details:      
 
Domain Number 2 Region: 327-373,423-486
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 0.0000516
Family TrmB middle domain-like 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000014645   Gene: ENSAMEG00000013879   Transcript: ENSAMET00000015252
Sequence length 518
Comment pep:known_by_projection scaffold:ailMel1:GL192595.1:1231623:1263812:1 gene:ENSAMEG00000013879 transcript:ENSAMET00000015252 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GAVRDRERRRSPWLLLAPLLSPAVPQVTSPPCCLCPEGVHRFQWIRNLVPEFGVSSSHVR
VLSSPAEFFELMKGQINVAKRRVVMASLYLGTGPLEQELVDCLESTLEKSLQAKFPSDLK
VSILLDFTRGSRGRKNSRTMLLPLLQRFPEQVRVSLFHTPNLRGLLRLLIPERFNETIGL
QHIKVYLFDNNVILSGANLSDSYFTNRQDRYVFLQDCAEIADFFTELVDAVGDVSLQLQG
DDTVHVVEGMVHPYKGDRAAYCRAANKRVMDVINSARARQQVLHAQTFHGDSLLTQEDAA
AAGDRRPAPDTWIYPLIQMKPFEIQIDEIVTESLLTEAERGARVYLTTGYFNLTQAYMDL
VLGTRAEYQILLASPEVNGFFGAKGVAGAIPAAYVHIERQFYRAVCSLGQQERVQLQEYW
RRGWTFHAKGLWLYLAGSSLPCLTLIGSPNFGYRSVHRDLEAQIAIVTESRALQQQLHQE
QERLYLRSGAVSSATFEQPSRQVKLWVKLVTPLIKNFF
Download sequence
Identical sequences G1M5M7
ENSAMEP00000014645 ENSAMEP00000014645

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]