SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000015175 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000015175
Domain Number 1 Region: 10-298
Classification Level Classification E-value
Superfamily WD40 repeat-like 5.13e-47
Family WD40-repeat 0.0026
Further Details:      
 
Domain Number 2 Region: 1008-1069
Classification Level Classification E-value
Superfamily HMG-box 0.000000824
Family HMG-box 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000015175   Gene: ENSAMEG00000014356   Transcript: ENSAMET00000015798
Sequence length 1128
Comment pep:known_by_projection scaffold:ailMel1:GL194793.1:15853:72205:1 gene:ENSAMEG00000014356 transcript:ENSAMET00000015798 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPATQKPMRFGHTEGHTDVCFDDLGSYIVTCGSDGDVRIWEDLDDDDPKSINVGEKAYSC
ALKNGKLVTAVSNNTIQIHTFPEGVPDGILTRFTTNANHVVFNGDGAKIAAGSSDFLVKV
VDVMDCSQQKTFRGHDAPVLSLSFDPKDIFLASASCDGSVKVWQISDQTCTISWPLLQKC
NDVINSKSICRLAWQPKSGKLLAVPVEKSVKLYRRETWNNQYDLSDNFISQALNVVTWSP
CGQYLAAGSINGLIIVWNVETKDCMERVKHEKGYAICGLAWHPSCGRIAYTDAEGNLGLL
ENVCEPSGKTSSSKVSSRVEKDYNDLFDGDDTNNAGDFLNDNAVETPSFSKRIINDEEED
DDLMLASGRPRQRSHILEDDENSVDVTMLKTGSSLLKEEEEDDQADSIHNLPLVTSQRPF
YDGPMPTPRQKPFQSGSTPMHLTHRFMVWNSIGIIRCYNDEQDNAIDVEFHDTSIHHATH
LSNTLNYTVADLSYEAILLACESTDELASKLHCLHFSSWDSSKEWIVDMPPKEDIETICL
GLGWAAAATSAMLLRLFTIGGVQKEVFSLPGPVVSMAGHGEQLFIVYHRGAGFDGDQCLG
VQLLELGKKKKQILHGDPLPLTRKSYLVWVGFSAEGTPCYVDSEGIVRMLNRGLGNTWTP
ICNTREHCKGKSDHYWVVGIHENPQQLRCIPCKGSRFPPTLPRPAVAILSFKLPYCQIAT
EKGQMEEQFWRSIMFHNHLDYLAKNGYEYEESTKNQAVKEQQELLMKMLALSCKLDREFR
CVELADLMTQNAVSLAIKYASRSRRLILAQRLSELAVEKAAELAAPQMEEEEEEDFRKDL
NAGYNNTATEWSQPRLRNHVEEDVEDTGEADDIEEKPELHKHGKILFFFSLLSEGFFLMK
GAVTSSNQGRVNPFKVSASSKEPVTSMNSARSSNILDNMNKSSKKSTALNRATNNEKSPV
IKPLVPKPKSKQASAASYFQKRTSQTDKTEDVKEEHPKNSSSETPAMCPQNTENQRPKTG
FQMWLEENRSSILSDNPDFSDEADIIKEGMIRFRVLSAEERKAWASKAKGGTTSDGAEAK
KRKHVIDESHETENEKEKAKENLNLPKKQKSLDLSTNQKLSAFAFKQE
Download sequence
Identical sequences G1M755
ENSAMEP00000015175 ENSAMEP00000015175

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]