SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000015553 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000015553
Domain Number 1 Region: 653-936
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.15e-81
Family Protein kinases, catalytic subunit 0.00000000362
Further Details:      
 
Domain Number 2 Region: 66-237
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.02e-69
Family Ephrin receptor ligand binding domain 0.00000187
Further Details:      
 
Domain Number 3 Region: 362-565
Classification Level Classification E-value
Superfamily Fibronectin type III 4.08e-40
Family Fibronectin type III 0.00000393
Further Details:      
 
Domain Number 4 Region: 950-1019
Classification Level Classification E-value
Superfamily SAM/Pointed domain 2.09e-19
Family SAM (sterile alpha motif) domain 0.0000436
Further Details:      
 
Weak hits

Sequence:  ENSAMEP00000015553
Domain Number - Region: 291-359,410-416
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00262
Family Growth factor receptor domain 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000015553   Gene: ENSAMEG00000014652   Transcript: ENSAMET00000016201
Sequence length 1025
Comment pep:known_by_projection scaffold:ailMel1:GL192679.1:1084121:1114882:1 gene:ENSAMEG00000014652 transcript:ENSAMET00000016201 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RKGLGIICASQSRRGQASSARGGASPGLACWVSSPAPHGRGRACEVLLPGLGLLGLGAPS
MVASAVNLLDTSTIHGDWGWLTYPSHGWDSINEVDESFQPIHTYQVCNVMSPNQNNWLRT
SWVPRDGARRVYAEIKFTLRDCNSMPGVLGTCKETFNLYYLESDRDLGASTQESQFLKID
TIAADESFTGADLGVRRLKLNTEVRGVGPLSKRGFYLAFQDIGACLAILSLRIYYKKCPT
TVRNLAAFSEAVTGADSSSLVEVRGQCVRHSEERDTPKMYCSAEGAWLVPIGKCVCSAGY
EERRDACVACELGFYKSAAGDQLCARCPPHSHSAAPAAQACRCDLSYYRAALDPPSAACT
RPPSAPVNLISSVNGTSVTLEWAPPLDPGGRNDITYNAVCRRCPWALGHCETCGSGPRFV
PQQTSLVRASLMVANLLAHMNYSFWIEAVNGVSDLSPEPRRAAVVNITTNQAAPSQVVVI
RQERAGQTSVSLLWQEPEQPNGIILEYEIKYYEKDKEMQSYSTLKAVTTRATVSGLKPGT
RYMFQVRARTSAGCGRFSQAMEVETGKPREYETLSELPLLIGTETLALITGLVVLLLLLI
CKKRHCGYSKAFQDSDEEKMQYQNGPGKIPEPQFYAEPHNYEEPGRTGRSFTREIEASRI
HIEKIIGSGESGEVCYGRLQVPGQRDVPVAIKALKPGYTERQRRDFLSEASIMGQFDHPN
IIRLEGVVTRGRLAMIVTEYMENGSLDAFLRTHDGQLTIMQLVGMLRGVGAGMCYLSDLG
YVHRDLAARNVLVDSNLVCKVSDFGLSRVLEDDPDAAYTTTGGKIPIRWTAPEAIAFRTF
SSASDVWSFGVVMWEVLAYGERPYWNMTNRDVISSVEEGYRLPAPMGCPRALHQLMLDCW
HKDRAQRPRFSQIVGVLDALIRSPESLRATATVNRCLTPTPALPKSSGPPGISPVTVGDW
LDSNRMGRYRDHFAAGGYSSLGMVLRMNAQDVRALGITLMGHQKKILGSIQTMRAQLTST
QGPHR
Download sequence
Identical sequences G1M883
ENSAMEP00000015553 ENSAMEP00000015553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]