SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000015574 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000015574
Domain Number 1 Region: 779-872
Classification Level Classification E-value
Superfamily Immunoglobulin 1.36e-23
Family I set domains 0.018
Further Details:      
 
Domain Number 2 Region: 1067-1161
Classification Level Classification E-value
Superfamily Immunoglobulin 1.31e-22
Family I set domains 0.0042
Further Details:      
 
Domain Number 3 Region: 875-969
Classification Level Classification E-value
Superfamily Immunoglobulin 4.8e-21
Family I set domains 0.0059
Further Details:      
 
Domain Number 4 Region: 323-418
Classification Level Classification E-value
Superfamily Immunoglobulin 3.7e-20
Family I set domains 0.014
Further Details:      
 
Domain Number 5 Region: 971-1065
Classification Level Classification E-value
Superfamily Immunoglobulin 3.07e-19
Family I set domains 0.0029
Further Details:      
 
Domain Number 6 Region: 1163-1250
Classification Level Classification E-value
Superfamily Immunoglobulin 7.9e-19
Family I set domains 0.0073
Further Details:      
 
Domain Number 7 Region: 132-226
Classification Level Classification E-value
Superfamily Immunoglobulin 2.41e-18
Family I set domains 0.012
Further Details:      
 
Domain Number 8 Region: 421-508
Classification Level Classification E-value
Superfamily Immunoglobulin 2.88e-17
Family I set domains 0.017
Further Details:      
 
Domain Number 9 Region: 227-321
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000179
Family I set domains 0.0084
Further Details:      
 
Domain Number 10 Region: 686-776
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000314
Family I set domains 0.0071
Further Details:      
 
Domain Number 11 Region: 592-683
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000321
Family I set domains 0.0045
Further Details:      
 
Domain Number 12 Region: 39-128
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000106
Family I set domains 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000015574   Gene: ENSAMEG00000014770   Transcript: ENSAMET00000016223
Sequence length 1339
Comment pep:known_by_projection scaffold:ailMel1:GL192610.1:191129:204468:1 gene:ENSAMEG00000014770 transcript:ENSAMET00000016223 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLDRLGEQAAMLRTFTVLLFCIWLSLGMTSIGMTVVKSQPELWIETNYPQAPWENITLW
CKSPSRISSKFLRLKDKTQMTWIRPSSKTFQVSFPIGALTKSNAGLYRCCYWKETGWSDP
SKVLELVAPGQLPKPIFWIQAETSPLPGCNVNILCHGWLQDLVFMLFKEGYAETVDYQIP
TGTVAIFSIANMTPESEGVYICRTHIQMLPTLWSEPSNPLKLIVAGLYPKPTLTAYPGPI
MAPGESLNLRCQGPIYGMTFALIRLEDLEKSFYRKRPIKNEAYFFFRALKIHDAGHYLCF
YYDGSYRGSLLSDILKIWVTDAFPKTWLLAQPSPVVQMGQNVSLWCQGPVDGVGLALYKK
GEDKPLQLLDTTSIDDNKSFFLNNVTYSDAGIYSCHYLLSWKTSIRMTSHNTVELVVVDK
PPKPSLSAWPSTMFKLGKAITLQCRVPHPVLEFSLEWEERATFQKFSVDGDFIISNAEGK
GTGTYSCSYRVEAHPNIWSDRSEPLKLMGPAGFLTWNYVLNEAIRLSLIMQLVALLLVVL
WIRWKCRRHRIREAWLLGTAQGVTMLFIVTALLCCGLCNGVLTEETEIIMPTPKPELWAE
TNFPLAPWKNLTLWCRSPSGSTKEFVLLKDGTGWIATRPASEQVRAAFPLGALTQSHTGS
YHCHSWEEMAVSEPSEALELVGTDILPKPVMSASPPIRGQKLQIRCKGWLAGMEFVLYKE
GVQEPVQQLGAVGREAFFTIQRMEDKDEGNYSCRTHTEKRPFKWSEPSESLELVIKEMYP
KPFFKTWASPVVTPGARVTFNCSTPQQHMSFILYKDGSEIASSDRSWASPGASAAHFLIT
SVGTGDGGNYSCRYYDFTIWSEPSDPVELVVTEFYPKPILLALPGPVVLPGKNVTLHCQG
AFQDMRFALLQEGTQVPLQFQSTSRDSVDFLLHTVGVEDSGNYSCVYYETTMSNRGSHLS
KPIKIWVTDTFPKPWLFAEPSSVVPMGQNVTLWCQGPVHGVGYILHKEREATSVQLWGST
SKDGAFLITNISGANIGRYSCCYHPDWTSPIKIQPSNTLELIVTGLLPKPSLLAQPGPIV
APGENMTFQCQGELPDSTFVLLKEGTQEPLEQQSPRGYRADFWMPVVRGDDSGVYSCVYY
LDSAPFAASNRSDFLEIWVTDKPPKPLLSAWPSTVFKLGKDITLQCRGPLPGVEFVLEHD
GEEAPQQFSEDGDFIINNVEGKGIGNYSCSYRLQAYPDIWSEPSDALELVGAAGPAAQEC
TMGNIVRSSLIVVVVVALGVVLAIEWKKWPRLRTRDSETDGRDQTIALEECNQEEEPGAN
TSSPLSVSQGTSVELPVPI
Download sequence
Identical sequences G1M8A4
ENSAMEP00000015574 ENSAMEP00000015574

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]