SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000015659 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000015659
Domain Number 1 Region: 599-900
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.11e-83
Family Protein kinases, catalytic subunit 0.0000000000861
Further Details:      
 
Domain Number 2 Region: 7-181
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 7.23e-77
Family Ephrin receptor ligand binding domain 0.0000000123
Further Details:      
 
Domain Number 3 Region: 310-515
Classification Level Classification E-value
Superfamily Fibronectin type III 5.06e-41
Family Fibronectin type III 0.0000216
Further Details:      
 
Domain Number 4 Region: 896-966
Classification Level Classification E-value
Superfamily SAM/Pointed domain 2.47e-16
Family SAM (sterile alpha motif) domain 0.0000375
Further Details:      
 
Domain Number 5 Region: 239-310,348-367
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000255
Family Growth factor receptor domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000015659   Gene: ENSAMEG00000014794   Transcript: ENSAMET00000016311
Sequence length 968
Comment pep:known_by_projection scaffold:ailMel1:GL192679.1:1265990:1387219:1 gene:ENSAMEG00000014794 transcript:ENSAMET00000016311 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLAFLTETLMDSTTATAELGWIVHPPSGWEEVSGYDENMNTIRTYQVCNVFESSQNNWLR
TKFIRRRGAHRIHVEMKFSVRDCSSIPSVPGSCKETFNLYYYEADFDSATKTFPNWMENP
WVKVDTIAADESFSQVDLGGRVMKINTEVRSFGPVSRSGFYLAFQDYGGCMSLIAVRVFY
RKCPRIIQNGAVFQETLSGAESTSLVAARGSCIANAEEVDVPIKLYCNGDGEWLVPIGRC
MCKAGFEAVENGTVCRGCPSGTFKANQGDEACTHCPINSRTTSEGATNCVCRNGYYRADL
DPLDMPCTTIPSAPQAVISSVNETSLMLEWTPPRDSGGREDLVYNIICKSCGSGRGACTR
CGDNVQYAPRQLGLTEPRIYISDLLAHTQYTFEIQAVNGVTDQSPFSPQFASVNITTNQA
APSAVSIMHQVSRTVDSITLSWSQPDQPNGVILDYELQYYEKELSEYNATAIKSPTNTVT
VQGLKAGAIYVFQVRARTVAGYGRYSGKMYFQTMTEAEYQTSIQEKLPLIIGSSAAGLVF
LIAVVVIAIVCNRRGFERADSEYTDKLQHYTSGHMTPGMKIYIDPFTYEDPNEAVREFAK
EIDISCVKIEQVIGAGEFGEVCSGHLKLPGKREIFVAIKTLKSGYTEKQRRDFLSEASIM
GQFDHPNVIHLEGVVTKSTPVMIITEFMENGSLDSFLRQNDGQFTVIQLVGMLRGIAAGM
KYLADMNYVHRDLAARNILVNSNLVCKVSDFGLSRFLEDDTSDPTYTSALGGKIPIRWTA
PEAIQYRKFTSASDVWSYGIVMWEVMSYGERPYWDMTNQDVINAIEQDYRLPPPMDCPSA
LHQLMLDCWQKDRNHRPKFGQIVNTLDKMIRNPNSLKAMAPLSSGINLPLLDRTIPDYTS
FNTVDEWLEAGQYKESFANAGFTSFDVVSQMMMEDILRVGVTLAGHQKKILNSIQVMRAQ
MNQIQSVE
Download sequence
Identical sequences G1M8I9
ENSAMEP00000015659 ENSAMEP00000015659

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]