SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000015825 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000015825
Domain Number 1 Region: 518-628
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.36e-19
Family Spermadhesin, CUB domain 0.0015
Further Details:      
 
Domain Number 2 Region: 334-450
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000000000115
Family Spermadhesin, CUB domain 0.0047
Further Details:      
 
Domain Number 3 Region: 159-282
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000000000116
Family Spermadhesin, CUB domain 0.0073
Further Details:      
 
Domain Number 4 Region: 280-342
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000301
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 5 Region: 634-692
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000144
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 6 Region: 694-755
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000167
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 7 Region: 762-820
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000433
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 8 Region: 455-520
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000511
Family Complement control module/SCR domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000015825   Gene: ENSAMEG00000014966   Transcript: ENSAMET00000016483
Sequence length 914
Comment pep:known_by_projection scaffold:ailMel1:GL193584.1:82657:100233:-1 gene:ENSAMEG00000014966 transcript:ENSAMET00000016483 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTPRAQHPPPPQLLFLILLSCPWIQGLPLKEEEVLPEPGSEAPTVASEALAELLHGALL
RRGPEMGYLPGSDPDPTLATPPAGQTLAAPSLPRATEPGTGPLTTAVTPKPELLTPPPGT
TAPPLPGPASPGPPLVPEGGEEETTTTIITTTTVTTTVTSPVLCNNNISEGEGHVESPDL
GSVASRTAGLLDCTYSIHVYPGYGIEIQVQMLNLSREEELLVLAGGGSPGLAPRLLANSS
MLGEGQVLRSPTNRLLLHFQSPRVPRGGGFRIHYQAYLLSCGFPPRPAHGDVSVTDLHPG
GTATFHCDSGYQLQGEETLICLNGTRPAWSGEPPSCMASCGGTIHNATLGRIVSPEPGGA
AGPNLTCRWVIEAAEGRRLHLHFERVSLDEDNDRLMVRSGGSPLSPVIYDSDMDDVPERG
LISDAQSLYVELLSETPANPLLLSLRFEAFEEDRCFAPFLAHGNVTTTDPEYRPGALATF
SCLPGYALEPPGPPNAIECVDPTEPHWNDTEPACKAMCGGELSEAAGVVLSPDWPQSYSP
GQDCVWGLHVQEEKRILLQVEILNVREGDMLTLFDGDGPSARVLAQLRGPQPRRRLLSSG
PDLTLQFQAPPGPPNPGLGQGFVLHFKEVPRNDTCPELPPPEWGWRTASHGDLIRGTVLT
YQCEPGYELLGSDILTCQWDLSWSAAPPACQKIMTCADPGEINNGHRTTSDAGFPVGSHV
QYRCLPGYSLEGAAVLTCYSRDTGTPKWSDRVPKCALKYEPCLNPGVPENGYQTLYKHHY
QAGESLRFFCYEGFELIGEVTITCVPGHPSQWTSQPPLCKVAYEELLDNRKLEVTQTTDP
SRQLEGGNLALAILLPLGLVIVLGSGVYIYYTKLQGKSLFGFSGSHSYSPITVESDFSNP
LYEAGDTREYEVSI
Download sequence
Identical sequences G1M905
ENSAMEP00000015825 XP_002927391.1.58354 ENSAMEP00000015825

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]