SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000017414 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000017414
Domain Number 1 Region: 34-246
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.96e-63
Family SPRY domain 0.0000000171
Further Details:      
 
Domain Number 2 Region: 235-272
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000288
Family SOCS box-like 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000017414   Gene: ENSAMEG00000016489   Transcript: ENSAMET00000018125
Sequence length 273
Comment pep:novel scaffold:ailMel1:GL193256.1:392720:453662:-1 gene:ENSAMEG00000016489 transcript:ENSAMET00000018125 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGQKLSGSLKSVEVREPALRPAKRELQGAEPGRPARLDQLLDMPAAGPAVQLRHAWNPED
RSLNVFVKDDDRLTFHRHPVAQSTDGIRGKVGHARGLHAWQINWPARQRGTHAVVGVATA
RAPLHSVGYTALVGSDAESWGWDLGRSRLYHDGKNRPGVAYPAFLGPEEAFALPDSLLVV
LDMDEGTLSFVVDGQYLGVAFRGLKGKKLYPVVSAVWGHCEVTMRYINGLDPEPLPLMDL
CRRSIRLALGRPRLRDIGTLPLPQSLKNYLQYQ
Download sequence
Identical sequences D2HRZ1
ENSAMEP00000017414 ENSAMEP00000017414 XP_002925326.1.58354

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]