SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000018180 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000018180
Domain Number 1 Region: 718-976
Classification Level Classification E-value
Superfamily RNI-like 7.74e-44
Family 28-residue LRR 0.0000909
Further Details:      
 
Domain Number 2 Region: 2-90
Classification Level Classification E-value
Superfamily DEATH domain 1.18e-19
Family Pyrin domain, PYD 0.0000901
Further Details:      
 
Domain Number 3 Region: 1384-1469
Classification Level Classification E-value
Superfamily DEATH domain 0.0000000000000171
Family Caspase recruitment domain, CARD 0.034
Further Details:      
 
Domain Number 4 Region: 312-544
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000000138
Family Nucleotide and nucleoside kinases 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000018180   Gene: ENSAMEG00000017199   Transcript: ENSAMET00000018919
Sequence length 1484
Comment pep:known_by_projection scaffold:ailMel1:GL194617.1:135778:173082:1 gene:ENSAMEG00000017199 transcript:ENSAMET00000018919 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TAGRVQWRLAWYLDVMGKEELKEFQLRLSEKPLCGPSPGPTVAQLQQAGGLEVASHLVAQ
YGEQRAWDLALHTWEQMGLSGLCAQARAEAALMSAESPRFPCSPSAPSEQSPSGPTSTEV
LKFVQDPETGSRRQPPGTSGHMWNRDPSSPFYQALPSSPDQESPLQESPSAPTSTLVLEN
WKSLLHPSPEPRKQEASRAWWSLAETSANQSTEKDERERGRKEGWMDPSPFCIVPSLPQM
SHLSLPYVEIGESCQHQKRKRPWPAQSWENEDLHQEFIQLLLLHQPHPRRHESLIEWSYP
HGVVEKQGHLIEVKDLFGPGLGAQEEPRTVILHGVAGIGKSTMARQVRRAWKEGRLYRDR
FRYVVYVSCRELAQSETTSLAELITKGWAAPVPPIKQILSQPGQLLFILDDLDEPKWVLG
KQRPEGCVQWNEQQPVDTLLGRLLEKSLLPEASLLITARTLALQELIPSVGQPQWVEVLG
FSESGRKEYFYKYFKSESQAVTAFSLVELNQALLTMCLVPLVCWLVCTWLRKRMEREERL
SQVPQTATTLCLHYVSEALPAQPLGSQLRGLCSLAAEGTWQGKSLLSWQDFGKHELEEAT
VSALLETGILRKHPSPLTCCFAHRYLQEFFAAVSCVLGGEYEKSHPPDGVGGPDNLLKAY
GRFDVFGAPATHFVFGLLSKQGQREMEAVFQVKVPVERKHALLRWAAFEVWKPRHFPPLC
SLSTFRCLYEIQDEGFLTPMLASSDWASVCVHTSLELLLFMFCIRFCTVKKLYLNESGQH
SQPWGLVREALLRCVPMTDACWRVLFFTLRTTGNLKDLDLSGNHLSQSTVQSLCEALRFP
SCHLETLRLARCGLTAESCRDLASALSASQTLTQLELSVNLLLDAGAEHLCEGLRQPGCR
IHRLLLVGCGLTSGCCQALASTLSTSPSLTELDLRQNELEDVGVQLLCGGLKSPTCQLVL
LWLDQTKLSEEVIQMLRALEKEKPPLVIHSRWTPSVTIPNKVPSEEETSGLSSPEQQRQD
SEDLASPVPTEDLPSSVPTEDLPSPVPTEDLASPVSPEDLAFPVPTEDLASPVPPEDLHR
ELLGTKDDFWGPLGPVATELVDEDRSLYRVRLPVAGSYHWPNTGLRFVVRGPVTIDVEFC
AWDVGLRGMVPQQDWVVAGPLFDIKAEPGAVAAVYLPHFVDLRGGHVDTSLFQVAHLKEE
GMLVENPTRVELYHVVLEDPSFSPIGVLLRTINAALRFFPVISVVLLYHRLQLDEIAFHL
YLVPSDCCIQKAIDDKEKKFQFVQIHKPPPLAQLYVGSRYIVSGSGTLEAIPKELELCYR
SPGEPQIFSEFYVSHLGSGIRLQVRDKKYGTVVWEALVKPGDLRPAPSLVPPVPAASPSP
PGAPALLHFMDLHREQLVARVTSVEPVLDKLHGQVLSEEQYERVRAKRTTPGQMRELFSF
SRSWDRACKDQVYQALRETHPYLIMELWETGHSGAERGASPPAP
Download sequence
Identical sequences G1MFQ0
ENSAMEP00000018180 ENSAMEP00000018180

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]