SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000018201 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000018201
Domain Number 1 Region: 9-164
Classification Level Classification E-value
Superfamily TRADD, N-terminal domain 8.24e-66
Family TRADD, N-terminal domain 0.00000018
Further Details:      
 
Domain Number 2 Region: 220-307
Classification Level Classification E-value
Superfamily DEATH domain 0.0000000000000104
Family DEATH domain, DD 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000018201   Gene: ENSAMEG00000017232   Transcript: ENSAMET00000018940
Sequence length 311
Comment pep:novel scaffold:ailMel1:GL192596.1:1256566:1258568:-1 gene:ENSAMEG00000017232 transcript:ENSAMET00000018940 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATGPNGLDEWVGSAYLFVECSLDKVVLSDAYAHAQQKVPVYRALRTALTESGGSPDVLQ
ILKIHRSEPQLIVQVRFCGRQPCSRFLRAYREGSLRAALQGCLAAALALPSVPLQLELRA
SAERLDTLLTDEERCLSCIFAQKPDRLRDEELSELEDALRNLTCASGSQGGDTEVVPAPS
QSLATSLSKEKPPPPPPGQTFLFQGQPIVNRPLSLQDQQTFARSVGLKWRKVGRSLQRGC
RALRDPALDSLAYEYEREGLYEQAFQLLRRFVQAEGRRATLQRLVEALEENELTSLAEDL
LGLTNPDGSLA
Download sequence
Identical sequences D2H9D3
ENSAMEP00000018201 XP_011222212.1.58354 ENSAMEP00000018201

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]