SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000018355 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000018355
Domain Number 1 Region: 18-196
Classification Level Classification E-value
Superfamily p53-like transcription factors 3.73e-73
Family Rel/Dorsal transcription factors, DNA-binding domain 0.000000011
Further Details:      
 
Domain Number 2 Region: 191-323
Classification Level Classification E-value
Superfamily E set domains 4.2e-51
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.000000169
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000018355   Gene: ENSAMEG00000017369   Transcript: ENSAMET00000019096
Sequence length 528
Comment pep:known_by_projection scaffold:ailMel1:GL192492.1:605162:612095:1 gene:ENSAMEG00000017369 transcript:ENSAMET00000019096 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSDLFPLIFPSEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPT
IKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQC
VKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPAGRPLRLSPVLS
HPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFS
QADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEE
KRKRTYETFKSIMKKSPFNGPTDPRPPPRRIAVPSRSTPSVPKPAPQPYPFTPSLSTINF
EEFSPMVFPSGQIPNQTSALAPAPAPILAQAPAPAPAPPPIPKTTQAGEGTLSEALLHLQ
FDADEDLGALLGNSTDPAVFTDLASVDNSEFQQLLNQGVSVAPHTAEPMLMEYPEAITRL
VTGSQRPPDPAPAPLGASGLPNGLLSGDEDFSSIADMDFSALLSQISS
Download sequence
Identical sequences G1MG73
ENSAMEP00000018355 ENSAMEP00000018355

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]