SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000019275 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000019275
Domain Number 1 Region: 7-188
Classification Level Classification E-value
Superfamily p53-like transcription factors 2.86e-75
Family Rel/Dorsal transcription factors, DNA-binding domain 0.0000000466
Further Details:      
 
Domain Number 2 Region: 183-307
Classification Level Classification E-value
Superfamily E set domains 2.03e-45
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.00000342
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000019275   Gene: ENSAMEG00000018236   Transcript: ENSAMET00000020040
Sequence length 592
Comment pep:known_by_projection scaffold:ailMel1:GL193562.1:139614:161864:1 gene:ENSAMEG00000018236 transcript:ENSAMET00000020040 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KFSGGYNPCIEIIEQPRQRGMRFRYKCEGRSAGSIPGEHSTDNNRTYPSIQIMNYYGKGK
VRITLVTKNDPYKPHPHDLVGKDCRDGYYEAEFGQERRPLFFQNLGIRCVKKKEVKEAII
SRIRAGINPFNVPEQQLLDIEDCDLNVVRLCFQVFLPDEHGNLTTALPPVVSNPIYDNRA
PNTAELRICRVNKNCGSVRGGDEIFLLCDKVQKDDIEVRFVLNDWEAKGIFSQADVHRQV
AIVFKTPPYCRAITEPVTVKMQLRRPSDQEVSESMDFRYLPDEKDTYGNKAKKQKTTLLF
QKLWQDCAVNFPERPRPGTLVSTGEGRFIKKESNFSHGTVLTEMPRTSGVSSQADSYYSS
PVSISNALSHHTSPIPSMVSQPSSSWSSGPHPTSRAVSTNPLSGFSTGTLSSNPQGISPY
LEMPLESDLNASNACIYNSANDIGRMEAPSMSPADLYGISDGNMLPNCPMNMITPSNDSM
RETDNPRLVSMNLENPSCNSVLDPRDLRQLHQMSSPSMPAGTSSSTAAFVPQPEAFERSD
FNCTDNSMINESGPSNGTNPNSHGFVHSQYSSIGTMQNEQLSDSFAFEFFQG
Download sequence
Identical sequences G1MIU0
ENSAMEP00000019275 ENSAMEP00000019275

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]