SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000019498 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000019498
Domain Number 1 Region: 510-769
Classification Level Classification E-value
Superfamily NHL repeat 2.01e-47
Family NHL repeat 0.00000736
Further Details:      
 
Domain Number 2 Region: 360-456
Classification Level Classification E-value
Superfamily E set domains 2.67e-22
Family Filamin repeat (rod domain) 0.0035
Further Details:      
 
Domain Number 3 Region: 136-198
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000275
Family B-box zinc-binding domain 0.0022
Further Details:      
 
Domain Number 4 Region: 45-119
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000486
Family RING finger domain, C3HC4 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000019498   Gene: ENSAMEG00000018443   Transcript: ENSAMET00000020267
Sequence length 771
Comment pep:known scaffold:ailMel1:GL192370.1:2672107:2784619:1 gene:ENSAMEG00000018443 transcript:ENSAMET00000020267 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IHRSGRYGTRQQRAGSKTAGLPCQWSRMASEATHIPSPVVRQIDKQFLICSICLERYKNP
KVLPCLHTFCERCLQNYIPAHSLTLSCPVCRQTSILPEKGVAALQNNFFITNLMDVLQRT
PGSNVEESSILETVTAVAAGKPLSCPNHDGNVMDFYCQSCETAMCRECTEGEHAEHPTVP
LKDVVEQHKASLQVQLDAVNKRLPEIDSALQFISEIIHQLTNQKASIVDDIHSTFDELQK
TLNVRKSVLLMELEVNYGLKHKVLQSQLDTLLEGQESIKSCSNFTAQALNHGTETEVLLV
KKQMSEKLNELADQDFPLHPRENDQLDFIVETEGLKKSIHNLGTILTTNAVASETVATGE
GLRQTIIGQPMSVTITTKDKDGELCKTGNAYITAELSTPDGSVADGEILDNKNGTYEFLY
TVQKEGDFTLSLRLYDQHIRGSPFKLKVIRSADVSPTTEGVKRRVKSPGSGHVKQKAVKR
PASMYSTGKRKENPIEDDLIFRVGTKGRNKGEFTNLQGVAASTSGKILIADSNNQCVQIF
SNDGQFKSRFGIRGRSPGQLQRPTGVAVHPSGDIIIADYDNKWVSIFSSDGKFKTKIGSG
KLMGPKGVSVDRNGHIIVVDNKACCVFIFQPNGKIVTRFGSRGNGDRQFAGPHFAAVNSN
NEIIVTDFHNHSVKVFNQEGEFMLKFGSNGEGNGQFNAPTGVAVDSNGNIIVADWGNSRI
QVFDGSGSFLSYINTSADPLYGPQGLALTSDGHVVVADSGNHCFKVYRYLQ
Download sequence
Identical sequences G1MJG3
ENSAMEP00000019498 ENSAMEP00000019498

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]