SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000021199 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000021199
Domain Number 1 Region: 3-36
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000196
Family LDL receptor-like module 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000021199   Gene: ENSAMEG00000020145   Transcript: ENSAMET00000021968
Sequence length 39
Comment pep:novel scaffold:ailMel1:GL192456.1:376268:376384:1 gene:ENSAMEG00000020145 transcript:ENSAMET00000021968 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QQLCDPGEFLCHDHVTCVSQSWLCDGDPDCPDDSDESLD
Download sequence
Identical sequences D2H317
ENSAMEP00000021199 ENSAMEP00000021199

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]