SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000000724 from Ailuropoda melanoleuca 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000000724
Domain Number 1 Region: 290-432
Classification Level Classification E-value
Superfamily PH domain-like 1.01e-39
Family Third domain of FERM 0.00000942
Further Details:      
 
Domain Number 2 Region: 186-291
Classification Level Classification E-value
Superfamily Second domain of FERM 9.03e-37
Family Second domain of FERM 0.0000031
Further Details:      
 
Domain Number 3 Region: 105-185
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.1e-27
Family First domain of FERM 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000000724   Gene: ENSAMEG00000000602   Transcript: ENSAMET00000000748
Sequence length 1106
Comment pep:novel scaffold:ailMel1:GL193197.1:696577:777692:-1 gene:ENSAMEG00000000602 transcript:ENSAMET00000000748 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTESGSDSESKPEQEAEPQEAAAAQGPGSEPSSEEQHQALEQFEGAAHSTPVRKEVTDK
EREFAAGAAKQLEYQQLEDDKLSQKSSSSKLSRSPLKIVKKPKSMQCKVILLDGSEYTCD
VEKRSRGQVLFDKVCEHLNLLEKDYFGLTYRDAENQKNWLDPAKEIKKQIRSGAWHFSFN
VKFYPPDPSQLSEDITRYYLCLQLRDDIVSGRLPCSFVTLALLGSYTVQSELGDYDPDEC
GNDYISEFRFAPNHTKELEDKVIELHKSHRGMTPAEAEMHFLENAKKLSMYGVDLHHAKD
SEGVEIMLGVCASGLLIYRDRLRINRFAWPKVLKISYKRNNFYIKIRPGEFEQFESTIGF
KLPNHRAAKRLWKVCVEHHTFFRLLLPEAPPKKFLTLGSKFRYSGRTQAQTRRASALIDR
PAPYFERSSSKRYTMSRSLDGASVNENHEIYMKDSVSAAEVGTGQYATTKGISQTNLITT
VTPEKKAEEERDEEEDRRKKAEEVTPVAAVRHEGKSPGLGTDSCPPSPPSAHHPPASPPE
LRRRCKENEHQPPGLEPAKGTVRVHGEPTLDSDHKGKPSLGDQDVAFSYKQQTGKGTTLF
SFSLQLPESFPSLLDDDGYLSFPNLSETNLLPQSLQHYLPIRSPSLVPCFLFIFFFLLSA
SFSVPYALTLSFPLAMCLCYLEPKAASLSASLDNDPSDSSEEETDSERTDTAADGETTAT
ESDQEEDAELKAQELDKTQDDLMKHQTNISELKRTFLETSTDTAITNEWEKRLSTSPVRL
AARQEDAPMIEPLVPEETKQSSAEKLMDGSEIFSLLESARKPTEFIGGVTSSSQSWVQKT
EIKTGSSKIETETSQRPQPLSTEKVVQETVLVEERHVMNVHASGDASYVAGDDVDAAAQA
ASADASSLKGKEGSALTEGAKEEKGEVADRAVLEPEETAAASHEPEEEQSATIHVSETWE
QKPHFESSTVKTETISFGSVSPGGVKLEISTKEVPVVHTETKTITYESSQVDAGADLEPG
VLMSAQTITSETTSTTTTTHITKTVKGGISETRIEKRIVITGDADIDHDQALAQAIKEAK
EQHPDMSVTKVVVHKETEITPEDGED
Download sequence
Identical sequences G1L1H1
ENSAMEP00000000724 ENSAMEP00000000724

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]