SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000001705 from Ailuropoda melanoleuca 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000001705
Domain Number 1 Region: 195-336
Classification Level Classification E-value
Superfamily PH domain-like 1.17e-44
Family Third domain of FERM 0.00000011
Further Details:      
 
Domain Number 2 Region: 85-194
Classification Level Classification E-value
Superfamily Second domain of FERM 3.4e-38
Family Second domain of FERM 0.000000635
Further Details:      
 
Domain Number 3 Region: 486-573
Classification Level Classification E-value
Superfamily Moesin tail domain 4.58e-33
Family Moesin tail domain 0.0000039
Further Details:      
 
Domain Number 4 Region: 2-83
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.75e-25
Family First domain of FERM 0.0000102
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000001705   Gene: ENSAMEG00000001586   Transcript: ENSAMET00000001771
Sequence length 573
Comment pep:novel scaffold:ailMel1:GL194535.1:35687:57894:-1 gene:ENSAMEG00000001586 transcript:ENSAMET00000001771 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
INVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWFFGLQYQDTKNFSTWLKLNKK
VTAQDVRKESPLLFKFRAKFYPEDVSEELIQDITQRLFFLQVKEGILSDDIYCPPETAVL
LASYAVQSKYGDFNKEVHKSGYLAGDKLLPQRVLEQHKLNKDQWEERIQVWHEEHRGMLR
EDAVLEYLKIAQDLEMYGVNYFSIKNKKGSELWLGVDALGLNIYEQNDRLTPKIGFPWSE
IRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRRRKPDTIEVQQ
MKAQAREEKHQKQMERALLENEKKKREMAEKEKEKIEREKEELMERLKQIEEQTKKAQHE
LEEQTRRALELEQERKRAQSEAEKLAKERQEAEEAKEALLQASRDQKKTQEQLALEMAEL
TARISQLEMARQKKESEAVEWQQKAQMVQEDLEKTRAELKTAMSTPHVAEPAENEQDEQD
ENGAEASADLRADAMAKDRSEEERTTEAEKNERVQKHLKALTSELANARDESKKTANDMI
HAENMRLGRDKYKTLRQIRQGNTKQRIDEFESM
Download sequence
Identical sequences D2I4R2
ENSAMEP00000001705 ENSAMEP00000001705

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]