SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000001969 from Ailuropoda melanoleuca 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000001969
Domain Number 1 Region: 66-145
Classification Level Classification E-value
Superfamily EF-hand 0.00000000134
Family Calmodulin-like 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000001969   Gene: ENSAMEG00000001870   Transcript: ENSAMET00000002048
Sequence length 264
Comment pep:novel scaffold:ailMel1:GL192369.1:799388:801638:1 gene:ENSAMEG00000001870 transcript:ENSAMET00000002048 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PARMLLASAMRVLVLLLPLSQAAPKDGTARLDPEVQQQPLSNPFQPGQEQLRLLQNYLQG
LERMEKEPEHMTREQVLLYLFALHDYDQSGQLDGLELLSMLTAALAPGAADFPVANPVIL
VVDKVLETQDLNGDGLMTPAELINFPGEAPRHTEPKEPPEPQDVGRQSPLAKSLSGQELQ
GAPGPREDGGQVEARRESSEPVQEAGGQAEAEREAPGPGAEAPGQAEARDTGKEAAALPG
ETLESTDTPNEFEAHVIQLENDEI
Download sequence
Identical sequences G1L509
ENSAMEP00000001969 ENSAMEP00000001969

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]