SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000002773 from Ailuropoda melanoleuca 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000002773
Domain Number 1 Region: 2079-2205
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 6.99e-18
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0036
Further Details:      
 
Domain Number 2 Region: 2525-2582
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000706
Family TSP-1 type 1 repeat 0.00051
Further Details:      
 
Domain Number 3 Region: 2954-3012
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000105
Family TSP-1 type 1 repeat 0.00061
Further Details:      
 
Domain Number 4 Region: 2687-2739
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000262
Family TSP-1 type 1 repeat 0.00079
Further Details:      
 
Domain Number 5 Region: 3990-4047
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000523
Family TSP-1 type 1 repeat 0.00031
Further Details:      
 
Domain Number 6 Region: 4239-4296
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000183
Family TSP-1 type 1 repeat 0.00061
Further Details:      
 
Domain Number 7 Region: 3227-3275
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000353
Family TSP-1 type 1 repeat 0.00051
Further Details:      
 
Domain Number 8 Region: 2799-2855
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000235
Family TSP-1 type 1 repeat 0.00036
Further Details:      
 
Domain Number 9 Region: 3618-3668
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000955
Family TSP-1 type 1 repeat 0.00054
Further Details:      
 
Domain Number 10 Region: 3799-3852
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000115
Family TSP-1 type 1 repeat 0.00071
Further Details:      
 
Domain Number 11 Region: 3931-3990
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000405
Family TSP-1 type 1 repeat 0.0012
Further Details:      
 
Domain Number 12 Region: 1687-1736
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000484
Family TSP-1 type 1 repeat 0.001
Further Details:      
 
Domain Number 13 Region: 1263-1326
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000000013
Family ATI-like 0.066
Further Details:      
 
Domain Number 14 Region: 3381-3425
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000235
Family TSP-1 type 1 repeat 0.00084
Further Details:      
 
Domain Number 15 Region: 2211-2249
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000432
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 16 Region: 3061-3118
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000000484
Family BSTI 0.031
Further Details:      
 
Domain Number 17 Region: 1409-1446
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000524
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 18 Region: 2435-2471
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000537
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 19 Region: 3158-3218
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000068
Family TSP-1 type 1 repeat 0.002
Further Details:      
 
Domain Number 20 Region: 1484-1522
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000183
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number 21 Region: 2472-2525
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000196
Family TSP-1 type 1 repeat 0.0019
Further Details:      
 
Domain Number 22 Region: 4606-4659
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000249
Family TSP-1 type 1 repeat 0.0013
Further Details:      
 
Domain Number 23 Region: 457-519
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000000294
Family ATI-like 0.097
Further Details:      
 
Domain Number 24 Region: 1368-1404
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000034
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 25 Region: 814-874
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000000406
Family ATI-like 0.054
Further Details:      
 
Domain Number 26 Region: 2746-2795
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000497
Family TSP-1 type 1 repeat 0.00089
Further Details:      
 
Domain Number 27 Region: 4760-4809
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000051
Family TSP-1 type 1 repeat 0.0013
Further Details:      
 
Domain Number 28 Region: 1445-1479
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000511
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 29 Region: 3447-3495
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000706
Family TSP-1 type 1 repeat 0.0015
Further Details:      
 
Domain Number 30 Region: 1803-1863
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000000867
Family BSTI 0.045
Further Details:      
 
Domain Number 31 Region: 1742-1795
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000222
Family TSP-1 type 1 repeat 0.0013
Further Details:      
 
Domain Number 32 Region: 2358-2397
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000055
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number 33 Region: 4673-4722
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000615
Family ATI-like 0.057
Further Details:      
 
Domain Number 34 Region: 4145-4200
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000641
Family TSP-1 type 1 repeat 0.0021
Further Details:      
 
Domain Number 35 Region: 4919-4982
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000105
Family ATI-like 0.012
Further Details:      
 
Domain Number 36 Region: 3016-3056
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000119
Family TSP-1 type 1 repeat 0.0027
Further Details:      
 
Domain Number 37 Region: 4814-4871
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000164
Family BSTI 0.034
Further Details:      
 
Domain Number 38 Region: 2605-2650
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000262
Family ATI-like 0.025
Further Details:      
 
Domain Number 39 Region: 3290-3339
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000458
Family BSTI 0.036
Further Details:      
 
Domain Number 40 Region: 3868-3920
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000523
Family TSP-1 type 1 repeat 0.001
Further Details:      
 
Domain Number 41 Region: 4047-4106
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000948
Family ATI-like 0.063
Further Details:      
 
Domain Number 42 Region: 4304-4354
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000111
Family TSP-1 type 1 repeat 0.0024
Further Details:      
 
Domain Number 43 Region: 4416-4472
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000123
Family ATI-like 0.019
Further Details:      
 
Domain Number 44 Region: 3766-3815
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000136
Family VWC domain 0.032
Further Details:      
 
Domain Number 45 Region: 1899-1957
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000144
Family TSP-1 type 1 repeat 0.0013
Further Details:      
 
Domain Number 46 Region: 2855-2920
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000018
Family ATI-like 0.046
Further Details:      
 
Domain Number 47 Region: 961-1008
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000209
Family VWC domain 0.092
Further Details:      
 
Domain Number 48 Region: 4098-4165
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000377
Family Fibronectin type I module 0.071
Further Details:      
 
Domain Number 49 Region: 1647-1673
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000419
Family LDL receptor-like module 0.0029
Further Details:      
 
Domain Number 50 Region: 4974-5041
Classification Level Classification E-value
Superfamily FnI-like domain 0.000046
Family VWC domain 0.079
Further Details:      
 
Weak hits

Sequence:  ENSAMEP00000002773
Domain Number - Region: 3504-3561
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000132
Family ATI-like 0.083
Further Details:      
 
Domain Number - Region: 864-932
Classification Level Classification E-value
Superfamily FnI-like domain 0.000157
Family Fibronectin type I module 0.04
Further Details:      
 
Domain Number - Region: 915-967
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00048
Family BSTI 0.064
Further Details:      
 
Domain Number - Region: 1600-1633
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00301
Family LDL receptor-like module 0.0033
Further Details:      
 
Domain Number - Region: 1955-2016
Classification Level Classification E-value
Superfamily FnI-like domain 0.00335
Family VWC domain 0.059
Further Details:      
 
Domain Number - Region: 4353-4412
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00366
Family TSP-1 type 1 repeat 0.0048
Further Details:      
 
Domain Number - Region: 517-557
Classification Level Classification E-value
Superfamily FnI-like domain 0.009
Family Fibronectin type I module 0.089
Further Details:      
 
Domain Number - Region: 3672-3729
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0114
Family BSTI 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000002773   Gene: ENSAMEG00000002478   Transcript: ENSAMET00000002892
Sequence length 5137
Comment pep:novel scaffold:ailMel1:GL193067.1:181218:232151:-1 gene:ENSAMEG00000002478 transcript:ENSAMET00000002892 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLPAFLFGMAWALANGRWCEHTETFLVEEEVTPRQEDLVPCTSLYHYQRLGWQLDLSWS
GRAGLCPIYKPPETRPAARNRTVRACCPGWGGTHCTLAITALAGASPGGHCFATQQCQPQ
AGSANASAGSLEECCAWPWGHSWRDGSSWACLSCSSRHLPGNTAAPALLQPLAGAVAQFW
SQRQQLSATCATWSGFHYRTFDGRHYHFLGRCTYLLAGAADATWAVHLTPRGHCPQPEHC
QLARVMMGPEKVLIQGKNVSVNGKLVPDAESQLLQGLSLQWQGDWLVLSGGLGVTVRLDR
SSSVSISVDYELQGQTQGLCGVYNGQPEDDFLEPGGRLAVLAATFGNSWRLPDSEPGCLD
SVEAAQGCEDHPTGTEAGMEAEAQDVCHQLLDSPFRECHAQVPPAEYHQACLFAYCSGAP
AGSGREARREAVCTTLANYAQECAKQHIHVGWRKPGFCERLCPGGQLYSDCTSACPPSCS
AVGEGGEGSCREACVSGCECPPGLFWDGALCVPAARCPCYHRRRRYAPGDTVRQLCNPCV
CQDGRWLCAQAPCPAECAVGGDGHYLTFDGRSFSFRGSQGCRSSLVQDLKGQLLIVLEHG
ACDTGSCLHAVSVSLGDTHIQLRDSGAVLIDGQDAGLPWSGPKGLRVSRASSAFLLLRWP
GAQVLWGVSDPATYITLDPRHAHQVQGLCGTFTWNQQDDFLTPAGDVETSIAAFASKFQA
AGEGRCPSEDSAPLSPCGTHTQRHIFAEAACAVLRGPTFQECQGLVDREPFHLRCLAAVC
GCAPGKDCLCPVLAAFARRCAREGALSLWRTQTLCPVLCPAGQEYQECAPACGQNCGEPE
DCGELGSCVAGCNCPPGLLWDPEGECVPPSLCSCQLGTRRYAPGSATMKDCNHCVCQERG
LWNCSAHRCGPQQTFCPRDLVYIPGACLLTCDSPGASHPCPPDSTGNCVCPPGTVLLNER
CVSPELCPCRHGGQWYPPNATIQEDCNICVCQGRQWHCTSHQCGGWCQASGAPHYVTFDG
LAFTFPGACEYLLVREASGRFTVSAQNLPCGASGLTCTKALTVQLQSTAVHMLRGRAVTV
NGVSITLPKVYTGPGLSLRRAGLFLLLTTRLGLSLLWDGGTRVLVQLSPKFRGRVSGLCG
DFDGDASNDLRSRQGVLEPTAELAAHSWHLSPLCPEPGDLLHPCTVNAHRASWAHARCGV
LLQSLFARCHGEVPPQQYYEWCVHDACGCDSGGDCECLCSAVATYADECARHGFHVRWRS
QELCPLQCEGGQVYEACGPVCPPTCHDHGPEPGWDCQDVACVEGCFCPEGTLLHGGVCLE
PASCPCESGGGFFPPGTVLQKDCGNCTCQESQWLCGSAGTHCEEPAPGCVEGEAPCQESG
HCVPHTWLCDNQDDCGDGSDEEGCATPGCGEGQMSCSSGHCLPLALFCDGQDDCGDGTDE
QGCPCPHGSLACTDGRCLPPALLCDGHPDCPDAADEEACLGQLNCTPGEVSCVDGTCVGA
ILLCDGIWDCPDGADEGPGHCPFPSLPTPPAGTLPGPSAGFGETAPTPLASTSPGECPGG
AAEKGRRAGTGRRVGGGWRNFCPPTQAQGREERGFCLCPHLVPCGLAPQVCLNLEQLCDG
LSACSQGKDELGCEGMTAPGGPNRTRVPCPEYSCPDGLCISFQLVCDGQPDCGFAGELGP
SPEEQGCGAWGPWNSWGPCSRTCGPGVQGRSRHCSPPDLPVLQHCLGPEHQTQACFTAAC
PVDGEWTSWSSWSPCTEPCVGTTTRQRQCHQPQNGGRTCAMLPGGPPTTHQTRPCPQDGC
PNATCSGPLVFWPCAPCPLTCDEISAQAVCEANRPCSNPGCWCPAGQVLGSDGRCVWPRQ
CPCLLDGTPYRPGQRIKADCQLCTCQDGRLQRCRPDPDCAVNCGWSSWSPWAECLGPCGS
ENIQWSFRSPNNPRLSGQGRQCRGIRRKARRCRTEPCAGCEQQGQPRAVGERWREGPCGV
CQCLHNSTVRCSPYCPLGSCPQDWVLVEGVGGSCCHCALPGENQTVHPLATPAPSLALSA
QIGSPLVAYVLPPPGDPCYSPLGLALLPEGSPKLESPIQAALLGAPTKRPGFLGQSTQRR
TRPPYLQLDLLLPRNLTGIIVQGAGSSAFLQFSSDGLHWHNYTDILPGILPPAKLFPRNW
GDGAPTVQTFGQMVQAQHVRVWPHVPRRDPNQSIPLRVELLGCEPVSPLAAPPCPGGGHR
CASGECAPRGEPCDGAKDCEDGSDEEGCVPLPAATGRVWSTARTPALSSAQPGQLPRRPT
EGLAEAERWHPSRGSPIPPTGSHPLPPAPTGKEPVTQAPASEALRLSPRESVQTMTTTPT
SQVTPVAPAGQSVAPEPFPPVRCSPGQVPCEVLGCVEQGQLCDSREDCLDGSDERHCGRS
GITYVAPFPPASRAASPVPFTVPTTALPGLLASRAPCSPSQLSCGSGECLPAERRCDLRP
DCQDGSDEDGCVDCGLAPWSGWSSCSRTCGPGLAFQRRDLLRPPLPGGSCLSDRLRSQSC
FVQACPVAGAWAVWGAWGPCSVSCGGGHRSRQRSCVDPPPKNGGAPCPGASHEGAPCALQ
PCTGDTDCGLGRIHISTELCQKGLVPPCPPSCLDPEANRSCSGHCLEGCRCPPGLLLHDA
HCLPLSECPCLVGEELKPPGVPFLLDNCSRCTCEKGALLCEPGGCPVPCGWSAWSSWGPC
DRSCGSGVRARFRSPSNPPAASGGAPCEGDRQELQACHVECGTEAPGWTPWTPWSPCSRS
CLTVGGGPGWRSRSRLCPSPGDTSCPGKATQEEPCSPPVCPVPSSWGLWAPWSACSAPCD
GGIQRRGRSCSGSTPGDPECQGPHSQTRDCNTQPCTAQCPGDMVFRSAEQCQQDGGPCPQ
LCLAQDPGVECTSFCAPGCACPPGLFLHDARCLPRSRCPCQRHGQLYAPGARAQVDSCNN
CTCVSGEMVCTSEPCPVACGWSPWTPWSPCSRSCDVGVRRRFRAGTAPPAAFGGAACQGP
SMEAEFCSLRPCRGPGGEWGPWSPCSVPCGGGYRNRTRDGGLHGRVDFSACGLQPCAGPV
PGVCPRGKRWLDCAQGPASCAELSALQGTDQTCHPGCYCPSGMLLLNNVCVPSQDCPCAH
GGRLYPPGSVVLRLCENCSCVSGLITHCTSWPCEEGQPRWSPWTPWSECSASCGPARRHR
HRFCSEPPTTDPSIPTLPSPPTLPTPLCPGPDAEEEPCLLPGCDRAGGWGPWGPWSGCSR
SCGGGLRSRMRACDQPPPQGLGDYCEGPQAQGEACQALPCPVTNCTAVQGAEYSPCGPAC
PRSCDDLVHCMWRCQPGCYCPPGQVLSADGAFCVQPSHCGCLDLLSGERHRPGARLPRPD
GCNYCTCLEGRLNCTDLPCPVPGGWCPWSEWTACSQPCRGQTRTRSRACTCPAPQHGGTP
CPGKAGDAGAQHQKETCPSSPECPGTVDGAWSPWGLWSPCDPCLGQSHRSRECIWPPTPE
GGRPCPGGYRQSRPCQDNSTQCPDCGGGQGLLPCGWPCPRSCQDLSPGSVCQPGPTSCQP
SCGCPPGLLSQDGLCVPPVRCRCHYQPRAMGIPENESRSAGPGLSSWESLEPGEVVTGPC
DNCTCTEGILQCQEVPGCPGPGVWGTWGPWEDCSVSCGGGEQLRTRRCARPPCPGPARQS
RTCHTQVCREAGCPAGRLYRECPPSDVCPFSCTHITRQVACFSDGCEEGCHCPVGTFQHR
LSCVQECPCVLTASLLQELGAASADPGAWPPILGQGGQPLGPGDELGSGQSLHTDCRNCS
CVHGQLSCSVGDCSKAADGFSPWGPWGPCSRSCGGLGTRTRSRQCVRPSPAPGSQGCGGP
SQDLKYCSSPDCRGTGAGGSTVEPVTSLPVGWGPWSPWSPCSHTCTDPTHPAWRSRTRLC
LANCTGGDASQERPCNLPSCTELPLCPSPGCVAGNCSWTAWAPWEPCSRSCGVGQQRRLR
AYRPPGPGGHWCPDILTAYQERRFCNLRACPVPGGWSRWSPWSWCDRSCGGGRSLRSRSC
SSPPPKNGGAPCVGERHHVRLCNPLPCEEGCPAGMKMVSCANRCPRRCSDLQEGIVCQDG
QGCQAGCRCSEGFLEQVGGCVPIGHCECTDAQGQSWAPGSQHQEACNTCTCEAGQLSCTA
QPCPAPAHCAWSRWSAWSPCSSSCGPEGQQSRFRSSTSGSWAPECREEQSQSQPCPQPPC
PPLCLHSARLHTLGDSWLQGGGQQCSCTPEGIVCEDIECAVPGAWTLWSPWSECPVSCGG
GNQVRTRVCMASAPDHREGPCLGPGTQTQRCGWQPCLGLLEACSWGPWGPCSRSCGPGLA
SRSGSCPCPLAEVNPTCNGTFLHLDTQACYPGPCLEECVWSSWSSWTRCSCQVLVQQRYR
HQHPASGAGGAGAGSPCTRLDGHFRPCPIGNCSEDSCTPPFEFQACGSPCAGLCATHLSH
QLCQDRPPCQPGCYCPAGLLEQAGGCIPPEQCSCLHLTEEGPRGPPAPGDRLHLGCKECE
CQRGELQCTSQGCQGFLPLSGWSEWSPCGPCLPPGVLAPASRTALEERWSQHPTGLSPTL
APSLASEQHRHRLCLDPETGRPWAGDPDLCTAPLSQQRLCPDPGACHDLCQWSPWGPWSP
CQVPCSGGFRLRWRKAGGPPGGGCQGPWAQTESCNVGPCPGESCEARDTVPTLDCANRCP
RSCADLWDRVQCLQGPCRPGCRCPPGQLIQDGHCVPISSCRCGLPSPNASWVVAPAEVAQ
LDCKNCTCINGSLMCPHHECPVRGPWSAWSSCSAPCGGGTMERHRSCEEGPAGVPCQARD
TEQRQECNLQPCPDCLPGQVLRACASTCPRLCSHLQPGALCEQEPCQLGCGCPGQQLLHN
GTCVPPAECPCTQISLPWGLTFPLEEQARELPAGTVLTWNCTRCVCQDGAFNCSLADCHE
CPSGEMWQQVPPGKLGPCERTCREPNATETWGNCSAGPAPGCVCQHGHLRNQAGLCVPAH
HCECWHHGRLHPPGSEWQEACESCRCLRGRSVCTQHCAPLTCAQGEVIMQEPGSCCPTCR
QETLEEQPASCQHLTELRNLTKGPCYLEQVEVSYCSGHCPSSTNVMPEEPYLQSQCGCCS
YSLDPDSPVRILTLRCPGGRSVPGPLICSPGGDFSKH
Download sequence
Identical sequences G1L7A7
ENSAMEP00000002773 ENSAMEP00000002773

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]