SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000002919 from Ailuropoda melanoleuca 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000002919
Domain Number 1 Region: 238-365
Classification Level Classification E-value
Superfamily Second domain of FERM 1.02e-30
Family Second domain of FERM 0.0019
Further Details:      
 
Domain Number 2 Region: 369-470
Classification Level Classification E-value
Superfamily PH domain-like 1.23e-25
Family Third domain of FERM 0.0032
Further Details:      
 
Domain Number 3 Region: 13-103
Classification Level Classification E-value
Superfamily PDZ domain-like 0.000000000000013
Family PDZ domain 0.012
Further Details:      
 
Domain Number 4 Region: 149-200
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000517
Family Ras-binding domain, RBD 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000002919   Gene: ENSAMEG00000002780   Transcript: ENSAMET00000003043
Sequence length 1751
Comment pep:novel scaffold:ailMel1:GL192926.1:642555:700512:1 gene:ENSAMEG00000002780 transcript:ENSAMET00000003043 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SHVMQEESANAMEWEQLPAETLRQVTIHRDPIYGFGFVAGSERPMVVRSVRPGGPSEDKL
LAGDQIVAINEEDVSEAPRERFIELIRSAKEFIVLTVLHTHQSPKSAFISAAKKARLRSN
PAKVRFSEQVAVGETDAKMLKKEALLLIPNVLKVFLENGQIKSFTFDGRTTVKDVMVTLQ
DRLSLRYIEHFALVLEYAGPEQNHKFLLLQDKQPLAYVVQRTHYQGMKCLFRISFFPKDP
VELLRRDPAAFEYLYIQSRNDVIRERFGMDPKPEMLLGLSALHIYITVSATRPSQKISLK
NVEKEWGLEPFLPPSLLQGIKEKNLRKSLSQQLKAHQTHSPSGTKGSAIQAKLQYLRILN
ELPTFTGVLFNTVGLDEKQSATTLLVGPRHGISHVIDLKTNLTTVLSEFSKISKIQLFRE
NQGVARVETSIMDAKPLVLLMEWPEATNFACLIAGYCRLLLDSRKMVFSRPASQPLLPPM
IKADYMHSAHRPVPGGHLGKKESSYVGSMGTSPRKSSRCTPQPADSELVSFCYLHMREQR
KEQESRTDVNENLIFFEETRPRTKSDPTSRSSGQGYNVIPDDFDAASLDHEPCASRARSY
TLDNSLGAEALNFYCDSCKAKLQEQLGPRKGGRPGSSRDNMVDLMSLPPPGSEEEEEEEE
DESTSLLPAIAAPPPGFRDNSSDEDDPKRRAVQSQEQGRHLRGLLYDEIPVTLIDSVQTR
TVRDHAQELDDALVSTLQALEALAASEDGPHPPPPQTAGLIVLATITPESSLDSGHETNS
SELTDMSEMMSAMKQHQNTTYFLAQHLNKESLLARKDLPFRIQSCAAQAVLTAPYSLGRP
DPNPALQPAVTGQSPGPPGARRKLPPSESQPPQRERTYALAVHPALSPQLSEQKNLSLLS
PVPEDKGPGHMRAGLEMSLRAATPSLSEEQVSELRENLPKEVRLSPKLLLDPKGSMTPAI
ISAALQQVAYPKSLPAPGGAIVSPPSGGERRLEASTGRPEVSMARSEVSVMSGSASKNLK
FKMSPGAPETSRNSQQPLSPEVSSGSRAPTGSRADSLHLSPQEDRLPVQSFPLKSYLSRA
SRESLSKQSIGEVAGKAGPEGSKPTLHKQGTVSSQVEKGQLESTPQSSKFEETSLVPRAG
YSMALQSPSCQSRGQSPSCQPRGQSPLRPQPASRQVSTMPSRKLETTLDGAHLASEGPAK
PKSSRGPFRLRNLFSATFPTRQKKETDERQAQLQKVKQYELEFLEELLKPPSQGELPGTE
YLQPPAPGRCSCQLRSSPVQQGPGMSREQRRSCDCKRICRGGRPQHPQTPVPGLRERERD
WGPLTQRQPEAGLGLSLSSPTNAGRLRSTSLESRECRSDPESGVSCLTTCASGGECLGAP
NYRKLMRRYSISELDQGDRASLTSDIYPHPPLGMLPREAKEVEAGLPLGLGPKTKSLESP
TLGDPSYVQVAPETKGPRQMAVFSLPEEVYRKPADLDEDSESGKCCSIRYCFYYRKCDMA
DDGSDGKDELSYSIPMKILPGMKLDEQVVPVVSRTLQVLDAAACSSGSPDASRTQEIDLR
VSTFEGSLAKINALRAHAYGLPDGFLAARLDTNELLTVLRQCVASPEARAPKPYVSQISE
YKLELALKFKELRASCRRVANVDKSPTHMLAAITGSFQVLSSLMETFVRLVFIVRSEAQR
QELLAKVEEVVRNYTFLLRAAEESTTRNLSQQQQQQQAAAAVGAAPGHPPGSPTSATVMS
TFTRSLKTLIK
Download sequence
Identical sequences D2HJV8
ENSAMEP00000002919 ENSAMEP00000002919

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]