SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000003692 from Ailuropoda melanoleuca 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000003692
Domain Number 1 Region: 2175-2472
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 4.1e-97
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000000000714
Further Details:      
 
Domain Number 2 Region: 664-772
Classification Level Classification E-value
Superfamily Second domain of FERM 2.75e-33
Family Second domain of FERM 0.00021
Further Details:      
 
Domain Number 3 Region: 1349-1454
Classification Level Classification E-value
Superfamily PDZ domain-like 5.65e-28
Family PDZ domain 0.0000199
Further Details:      
 
Domain Number 4 Region: 1072-1182
Classification Level Classification E-value
Superfamily PDZ domain-like 1.31e-27
Family PDZ domain 0.0064
Further Details:      
 
Domain Number 5 Region: 774-880
Classification Level Classification E-value
Superfamily PH domain-like 8.3e-26
Family Third domain of FERM 0.0024
Further Details:      
 
Domain Number 6 Region: 1782-1871
Classification Level Classification E-value
Superfamily PDZ domain-like 1.97e-21
Family PDZ domain 0.013
Further Details:      
 
Domain Number 7 Region: 1489-1594
Classification Level Classification E-value
Superfamily PDZ domain-like 2.89e-20
Family PDZ domain 0.034
Further Details:      
 
Domain Number 8 Region: 1873-1965
Classification Level Classification E-value
Superfamily PDZ domain-like 1.84e-17
Family PDZ domain 0.039
Further Details:      
 
Domain Number 9 Region: 570-663
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.92e-16
Family First domain of FERM 0.014
Further Details:      
 
Weak hits

Sequence:  ENSAMEP00000003692
Domain Number - Region: 2-154
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.000381
Family Protein kinases, catalytic subunit 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000003692   Gene: ENSAMEG00000003426   Transcript: ENSAMET00000003840
Sequence length 2487
Comment pep:novel scaffold:ailMel1:GL192364.1:1741494:1880102:-1 gene:ENSAMEG00000003426 transcript:ENSAMET00000003840 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHVSLAEALEVRGGPLQEEEIWAVLNQSAESLQELFRKVSIADPAALGFIISPWSLLLLP
SGSVSFTDENISNQDLRAFTAPEVLQNQSLTSLSDVEKIHIYSLGMTLYWGADHEVPQSQ
PIKLGDHLNSILLGMCEDVIYARVSVRTVLDACSAHIRNSNCAPSFSYVKQLVKLVLGNL
SGTDQLSHNSEQKPDRSQAIRDRLRGKGLPTGRSATSDVLDIHKSPFSHQTFLNKGLSKS
MGFLSIRDTQDEEDYFKDISSDNNSGHEDSENACSPYLFKTSGPEKKILPGIDVLPKKKI
WASSMDLLCTADRDFPGETGGFRQYLPEAVTVRTSTTPRKKEARYSDGSIALDIFGPQKV
DPVFHMRELPTSSAISSALDRIRERQKKLQVLREAMNVEEPIRRYKTYHSDIFSTSSESP
SIISSESDFRQVRKSEASKRFESNSGLPGVDENPSQGQRPSRQYETPLEGSVINQEIMLK
RQEEEMMQLQARMALRQSRLSLYPGDTIKASMLDISRDPLREMALETAMTQRKLRNFFGP
EFVKMTIEPFISLDLPRSILAKKGKNEDNRRKVNIMLLSGQRLELTCDTKTICKDVFDMV
VAHIGLVEHHLFALATLKDNEYFFVDPDLKLTKVAPEGWKEEPKKKSKAAVNFTLFFRIK
FFMDDVSLIQHTLTCHQYYLQLRKDILEERMHCDDETSLLLASLALQAEYGDYQPEVHGV
SYFRLEHYLPPRVMEKLDLSYVKEELPKLHNTYVGASEKETELEFLKVCQRLTEYGVHFH
RVHPEKKSQTGILLGVCSKGVLVFEVHNGVRTLVLRFPWRETKKISFSKKKITLQNTSDG
IKHAFQTDNSKVCHYLLHLCSCQHKFQLQMRARQSNQDAQDIERASFRSLNLQAESVRGF
NMGRAISTGSLASSTLNKLAVRPLSVQAEILKRLSCSELSLYQPLQNNAKEKSDKASWEE
KPRGMSKSYHDLSQASLYPHRKNVTVNMESPPQTIAELIGKPLHQMARSDTESLAGVTKL
NNSKSVASLSRSPERRKHESDSSFEDPGQAYVVGMTLHSSGNSSSQVPLKENDVLHKRWS
IVSSPEREITLVNLKKDAKYGFGFQIIGGEKMGRLDLGVFISSITPGGPADLDGCLKPGD
RLISVNSVSLEGVSHHAAVEILQNAPEDVTLVISQPKEKIPKVPSTPVHIANGMKNYMKK
PSYMQDNAVDSSEDHRWPHGTARHISESSFGLSGGLREGSLSSQDSRTESASLSQSQVNG
FFANPVGDRTWQESQHGSPSPSVIFKTTEKKRISTVSNQSKTKTPGISDATDYSDHGDSD
MDEATYSSSQDHQTPKKESSSSMNTSNKMNFKTFPSSPPKPGDIFEVELAKNDNSLGISV
TGGVNTSVRHGGIYVKAVIPKGAAESDGRIHKGDRVLAVNGVSLEGATHKQAVETLRNTG
QVVHLLLEKGQSPASKEHVPVTPQCTLPDPDAQGQAPEKMKKMTHVKDYSFVTAENTFEV
KLFKNSSGLGFSFSREDSLIPEQMNASIVRVKKLFPGQPAAESGKIDVGDVILKVNGASL
KGLSQQEVISALRGTSPEVSLLLCRPSPGVLPEIDPALLTPLHSLAQVLPNNSKDSSQPA
CVEQGTSSDENEMYDKSKKQCVSPSRRDSYSDSSGSGEEDLVKAPAMIPSMSWSSSLHQT
LNNMVSQAQSQHEASKSQEDTICTMFYYPQNIPSKPELEDSNPPSPLPPDMTLGLSYQPQ
AESASTNLMDKYHIYHISEPTRQESLTSLKNNLENHLEDFELEVELLITLSKSEKGSLGF
TVTKGNQSIGCYVHDVIQDPAKSDGRLRPGDRLIKVNDTDVTNMTHTDAVNLLRAAPKTV
KLVLGRVLELPRMPVLPHLLPDITLTCSKEELGFSLSGGHDSLHQVVYISDINPSSVAAI
EGNLQLLDIIHYVNGASTQGMTLEEAKTALDMSLPSVVLKATRHRDGHPVVPSSKRSAVS
TPQSTKANGHHPVEPCHKPALTPSNSFSKVNGEEIIEVLYPEGKCSTYQMKGSANLILSK
ESNVQEDDIYDDPQEAEVIQSLLDVVDEEAQNLLNQNSAAGDACVPGSLKTNGKLSEERA
EDTDCDGSPLPEDFAESVKMNGCEKYCEEKVKSESLIQKSQERKPDDDDEITWGSDELPI
ETTNHEDSNKDHPFLTNEELAALPIVKVLPSGKYTGTKLKSVIRTLRGLLDQGIPSKELE
NLQELKPLDQCLIGQTKENRRKNRYKNILPYDATRVPLGDEGGYINASFIRIPVGKEEFA
YIACQGPLPTTVGDFWQMIWEQKSTVIAMMTQEIEGEKIKCQRYWPNILGQTTMVSDRLR
LALVRMQQLKGFVVRAMALEEIQTGEIRHISHLNFTAWPDHDTPSQPDDLLTFISYMRHI
HRSGPIITHCSAGIGRSGTLICIDVVLGLISQDLEFDIADLVRCMRLQRHGMVQTEDQYI
FCYQVILYVLTRLQAEEEQKEQTQLLK
Download sequence
Identical sequences G1L9W9
ENSAMEP00000003692 ENSAMEP00000003692

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]