SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000004168 from Ailuropoda melanoleuca 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000004168
Domain Number 1 Region: 166-310
Classification Level Classification E-value
Superfamily PH domain-like 7.99e-42
Family Third domain of FERM 0.00024
Further Details:      
 
Domain Number 2 Region: 481-689
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.57e-36
Family DBL homology domain (DH-domain) 0.00073
Further Details:      
 
Domain Number 3 Region: 812-969
Classification Level Classification E-value
Superfamily PH domain-like 5.09e-29
Family Pleckstrin-homology domain (PH domain) 0.0031
Further Details:      
 
Domain Number 4 Region: 66-168
Classification Level Classification E-value
Superfamily Second domain of FERM 1.05e-27
Family Second domain of FERM 0.00013
Further Details:      
 
Domain Number 5 Region: 675-797
Classification Level Classification E-value
Superfamily PH domain-like 1.77e-27
Family Pleckstrin-homology domain (PH domain) 0.01
Further Details:      
 
Domain Number 6 Region: 2-65
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.22e-18
Family First domain of FERM 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000004168   Gene: ENSAMEG00000003908   Transcript: ENSAMET00000004335
Sequence length 986
Comment pep:novel scaffold:ailMel1:GL192405.1:1739692:1831264:1 gene:ENSAMEG00000003908 transcript:ENSAMET00000004335 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QRAPGKVLLDAVCNHLNLVEGDYFGLEFPDHKKITVWLDLLKPIVKQIRRPKHVVVKFVV
KFFPPDHTQLQEELTRYLFALQVKQDLAQGRLTCNDTSAALLISHIVQSEIGDFDEASDR
EHLAKNKYIPQQDALEDKIVEFHHNHIGQTPAESDFQLLEIARRLEMYGIRLHPAKDREG
TKINLAVANTGILVFQGFTKINAFNWAKVRKLSFKRKRFLIKLRPDANSSYQDTLEFLMA
SRDFCKSFWKICVEHHAFFRLFEEPKPKPKPVLFSRGSSFRFSGRTQKQVLDYVKEGGHK
KVQFERKHSKIQSIRSLAAPPTEPNSEVPKQECLLLGDVLFEQRGEQPLLGSSFSCRKLK
VAAEEPRQSPTLPKSPAGSGKVDGAAQAPADEEEEVVKDRTQQSKAQPPQPSTGSLTGSP
HLSELSINSQGGAVPASVILSPNLSPDTKQASPLVSPLLNDQACPRTDDEEEGRRKKSPT
DKAYFIAKEVSTTERTYLKDLEVITSWFQSTVSKEDAMPEALKSLIFPNFEPLHKFHTSF
LKETEQRLALWEGRSNAHIRGDYQRIGDVLLKNIQGMKQLAAHLWKHSEALEALETGIRS
SRRLETVCRDFELQKVCYLPLNTFLLRPLHRLMHYKQVLERLGGGGPHFRDCRAALAEIT
EMVAQLHGTMIKMENFQKLHELKKDLIGIDNLVIPGREFIRLGSLSKLSGKGLQQRMFFL
FNDVLLYTSRGLTASNQFKVHGQLPLYGMTIEESEDEWGVPHCLTLRGQRQSIVVAASSR
SEMEKWVEDIQMAIDLAEKSSGPTPEFLASSPPDNKSPDEAAVADQESEDDLSASRTSLE
RQAPHRGNTMVHVCWHRNTSVSMVDFSVAVENQLSGNLLRKFKNSSGWQKLWVVFTNFCL
FFYKSHQDNQPLASLPLLGYSLTLPSEAEGVHKDFVFKLQFRSHVYYFRAESEYTFDSLR
WMEVIRSATSSASRAHILSHKESHVY
Download sequence
Identical sequences G1LB95
ENSAMEP00000004168 ENSAMEP00000004168

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]