SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000004307 from Ailuropoda melanoleuca 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000004307
Domain Number 1 Region: 544-589
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000327
Family TSP-1 type 1 repeat 0.00091
Further Details:      
 
Domain Number 2 Region: 101-133
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000481
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 3 Region: 40-88
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000131
Family TSP-1 type 1 repeat 0.0034
Further Details:      
 
Weak hits

Sequence:  ENSAMEP00000004307
Domain Number - Region: 497-535
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0265
Family EGF-type module 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000004307   Gene: ENSAMEG00000004055   Transcript: ENSAMET00000004479
Sequence length 589
Comment pep:novel scaffold:ailMel1:GL194614.1:97618:159052:1 gene:ENSAMEG00000004055 transcript:ENSAMET00000004479 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFAAAFFILSLMTCQPGVTIQEKVNRRVSRAAPSSSASAVSCQLSNWSEWTDCFPCQDKK
YRYRSLLQPSKFGGAICSGDVWDQASCHSPTACLRQAQCGQDFQCKETGRCLKRHLVCNG
DKDCLDGSDEDDCEDVRVPEDDCSLYEPIPGSENAALGYNILTQEETQSVYDARYYGGQC
ETVYNGEWRELRYDPACERLYYGEDEKYFRKPYNFLKYHFEALADTRLSSELYDDARGLL
SKVKNDKSVSAGVSVGVGPAGIPVTVGVGVSGSRDSSLSNELNKYNEKKYNFMRIFTKVQ
TAHFKMRRDKIVLDEGMLQSLMELPEQYNYGVYAKFINDYGTHYITSGSMGGVYEYILVL
DREKMESLGITSRDIKSCFGGLVGIEYDYSESITIGGKLSGDHCKKSGGGDTKSDMLAMA
VVDIISRVRGGSSGWGGGLTQNRSTITYRSWGRSLKYNPVVIDFEMQPIHEVLRHTTLGP
LETKRQNLHRALDQYLMEFNACRCGPCFNNGEPILEGTSCRCQCPLGRKGFACEQMEQEG
AKADGRWSCWSSWSACRAGTQERRRECNNPAPQHGGASCPGWKAQTRAC
Download sequence
Identical sequences G1LBN3
ENSAMEP00000004307 ENSAMEP00000004307 XP_002930374.1.58354

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]