SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000004467 from Ailuropoda melanoleuca 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000004467
Domain Number 1 Region: 154-277
Classification Level Classification E-value
Superfamily PH domain-like 1.69e-26
Family Third domain of FERM 0.0051
Further Details:      
 
Domain Number 2 Region: 55-151
Classification Level Classification E-value
Superfamily Second domain of FERM 4.97e-23
Family Second domain of FERM 0.001
Further Details:      
 
Domain Number 3 Region: 1-54
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000000227
Family First domain of FERM 0.0021
Further Details:      
 
Domain Number 4 Region: 352-401
Classification Level Classification E-value
Superfamily RING/U-box 0.00000471
Family RING finger domain, C3HC4 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000004467   Gene: ENSAMEG00000004229   Transcript: ENSAMET00000004647
Sequence length 416
Comment pep:novel scaffold:ailMel1:GL192999.1:334417:352586:1 gene:ENSAMEG00000004229 transcript:ENSAMET00000004647 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VCRRLGIIEVDYFGLQFTGSKGESLWLNLRNRISQQMDGLAPYRLKLRVKFFVEPHLILQ
EQTRHIFFLHIKETLLAGHLQCSPEQAVELSALLAQTKFGDYNQNTAKYSYEELCAKELS
STTLNSIVAKHKELEGTGQASAEYQVLQIVSAMENYGIEWHSVRDSEGQKLLIGVGPEGI
SICKDDFCPINRIAYPVVQMATQSGKNVYLTVAKESGNSVVLLFKMISTRAASGLYRALT
ETHAFYRCDTVTSAVMMQYSRDLKGHLASLFLNENINLGKKYVFDIKRTSKEVYDHARRA
LYNAGVVDLVSRSDHSPPNSPLKSSESSMNCASCEGLSCQQTRALQEKLRKLKEAMLCMV
CCEEEINSAFCPCGHTVCCEGCAAQLQSCPVCRSRVEHVQHVYLPTHTSLLNLTVI
Download sequence
Identical sequences G1LC42
ENSAMEP00000004467 ENSAMEP00000004467

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]