SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000004987 from Ailuropoda melanoleuca 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000004987
Domain Number 1 Region: 3028-3286
Classification Level Classification E-value
Superfamily YWTD domain 9.55e-57
Family YWTD domain 0.0000016
Further Details:      
 
Domain Number 2 Region: 1268-1533
Classification Level Classification E-value
Superfamily YWTD domain 1.44e-52
Family YWTD domain 0.00000192
Further Details:      
 
Domain Number 3 Region: 1891-2151
Classification Level Classification E-value
Superfamily YWTD domain 4.32e-45
Family YWTD domain 0.0000114
Further Details:      
 
Domain Number 4 Region: 1583-1840
Classification Level Classification E-value
Superfamily YWTD domain 6.41e-44
Family YWTD domain 0.000018
Further Details:      
 
Domain Number 5 Region: 3868-4142
Classification Level Classification E-value
Superfamily YWTD domain 8.11e-44
Family YWTD domain 0.00000531
Further Details:      
 
Domain Number 6 Region: 538-773
Classification Level Classification E-value
Superfamily YWTD domain 2.49e-40
Family YWTD domain 0.0000101
Further Details:      
 
Domain Number 7 Region: 202-466
Classification Level Classification E-value
Superfamily YWTD domain 1.96e-38
Family YWTD domain 0.0000808
Further Details:      
 
Domain Number 8 Region: 2200-2469
Classification Level Classification E-value
Superfamily YWTD domain 2.09e-34
Family YWTD domain 0.0000309
Further Details:      
 
Domain Number 9 Region: 2943-3020,3279-3340
Classification Level Classification E-value
Superfamily Growth factor receptor domain 3.3e-21
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 10 Region: 1181-1260,1526-1578
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000416
Family Growth factor receptor domain 0.021
Further Details:      
 
Domain Number 11 Region: 847-889
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000055
Family LDL receptor-like module 0.0000883
Further Details:      
 
Domain Number 12 Region: 3568-3608
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000969
Family LDL receptor-like module 0.00063
Further Details:      
 
Domain Number 13 Region: 928-967
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000017
Family LDL receptor-like module 0.00079
Further Details:      
 
Domain Number 14 Region: 26-65
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000275
Family LDL receptor-like module 0.00085
Further Details:      
 
Domain Number 15 Region: 3368-3408
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000038
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 16 Region: 3611-3647
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000038
Family LDL receptor-like module 0.00047
Further Details:      
 
Domain Number 17 Region: 1012-1049
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000393
Family LDL receptor-like module 0.0000983
Further Details:      
 
Domain Number 18 Region: 2692-2729
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000406
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 19 Region: 888-930
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000419
Family LDL receptor-like module 0.00056
Further Details:      
 
Domain Number 20 Region: 973-1010
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000563
Family LDL receptor-like module 0.00087
Further Details:      
 
Domain Number 21 Region: 3487-3526
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000615
Family LDL receptor-like module 0.00078
Further Details:      
 
Domain Number 22 Region: 3530-3569
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000877
Family LDL receptor-like module 0.00083
Further Details:      
 
Domain Number 23 Region: 2732-2766
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000196
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 24 Region: 2559-2599
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000236
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number 25 Region: 2814-2849
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000353
Family LDL receptor-like module 0.00099
Further Details:      
 
Domain Number 26 Region: 2851-2891
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000419
Family LDL receptor-like module 0.00058
Further Details:      
 
Domain Number 27 Region: 3447-3485
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000471
Family LDL receptor-like module 0.00087
Further Details:      
 
Domain Number 28 Region: 1056-1096
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000589
Family LDL receptor-like module 0.00015
Further Details:      
 
Domain Number 29 Region: 2599-2638
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000877
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 30 Region: 3410-3448
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000107
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 31 Region: 2904-2939
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000122
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 32 Region: 3330-3365
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000131
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 33 Region: 2772-2806
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000196
Family LDL receptor-like module 0.00083
Further Details:      
 
Domain Number 34 Region: 3736-3772
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000406
Family LDL receptor-like module 0.0025
Further Details:      
 
Domain Number 35 Region: 144-191
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000837
Family EGF-type module 0.004
Further Details:      
 
Domain Number 36 Region: 2523-2560
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000118
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 37 Region: 1845-1886,2157-2193,2471-2523
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000204
Family Growth factor receptor domain 0.022
Further Details:      
 
Domain Number 38 Region: 1142-1177
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000249
Family LDL receptor-like module 0.0024
Further Details:      
 
Domain Number 39 Region: 1105-1139
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000668
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 40 Region: 73-108
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000798
Family LDL receptor-like module 0.0025
Further Details:      
 
Domain Number 41 Region: 2657-2688
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000101
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 42 Region: 3652-3694
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000419
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 43 Region: 3691-3727
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000367
Family LDL receptor-like module 0.0034
Further Details:      
 
Domain Number 44 Region: 4194-4229
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000385
Family EGF-type module 0.031
Further Details:      
 
Weak hits

Sequence:  ENSAMEP00000004987
Domain Number - Region: 488-524
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00057
Family EGF-type module 0.016
Further Details:      
 
Domain Number - Region: 4231-4268
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000586
Family EGF-type module 0.042
Further Details:      
 
Domain Number - Region: 4267-4302
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000607
Family EGF-type module 0.041
Further Details:      
 
Domain Number - Region: 3822-3857
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00101
Family EGF-type module 0.012
Further Details:      
 
Domain Number - Region: 805-842
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00239
Family EGF-type module 0.024
Further Details:      
 
Domain Number - Region: 117-152
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0033
Family EGF-type module 0.027
Further Details:      
 
Domain Number - Region: 4374-4409
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00502
Family EGF-type module 0.033
Further Details:      
 
Domain Number - Region: 3781-3830
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0638
Family EGF-type module 0.049
Further Details:      
 
Domain Number - Region: 4150-4182
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0686
Family EGF-type module 0.019
Further Details:      
 
Domain Number - Region: 4305-4338
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0871
Family EGF-type module 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000004987   Gene: ENSAMEG00000004561   Transcript: ENSAMET00000005191
Sequence length 4543
Comment pep:novel scaffold:ailMel1:GL192457.1:989710:1068666:1 gene:ENSAMEG00000004561 transcript:ENSAMET00000005191 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLTPPLPLLLLLPLLSAFVAAAIDAPKTCSPKQFACRDQITCISKGWRCDGERDCPDGSD
EAPEICPQSKAQRCQPNEHNCLGTELCVLMSRLCNGVQDCADGSDEGPHCRELQGPCSQL
GCQHHCVPTLNGPTCYCNNSFQLQADGKTCKDFDECSVYGTCSQLCTNTDGSFTCGCVEG
YLLQPDNRSCKAKNEPVDRPPVLLIANSQNILATYLSGAQVSTITPTSTRQTTAMDFSYA
NETVCWVHVGDSAAQTQLKCARMPGLKGFVDEHTINISLSLHHVEQMAIDWLTGNFYFVD
DIDDRIFVCNRNGDTCVTLLDLELYNPKGIALDPAMGKVFFTDYGQIPKVERCDMDGQNR
TKLVDSKIVFPHGITLDLVSRLVYWADAYLDYIEVVDYEGKGRQTIIQGILIEHLYGLTV
FENYLYATNSDNANAQQKTSVIRVNRFNSTDYQVVTRVDKGGALHIYHQRRQPRVRSHAC
ENDQFGKPGGCSDICLLANSHKARTCRCRSGFSLGSDGKSCKKPEHELFLVYGKGRPGII
RGMDMGAKVPDEHMIPIENLMNPRALDFHAETGFIYFADTTSYLIGRQKIDGTERETILK
DGIHNVEGVAVDWMGDNLYWTDDGPKKTISVARLEKAAQTRKTLIEGKMTHPRAIVVDPL
NGWMYWTDWEEDPKDSRRGRLERAWMDGSHRDIFVTSKTVLWPNGLSLDIPAGRLYWVDA
FYDRIETILLNGTDRKIVYEGPELNHAFGLCHHGNYLFWTEYRSGSVYRLERGAGSAPPT
VTLLRSERPPIFEIRMYDAQQQQVGTNKCRVNNGGCSLATPGSRQCACAEDQVLDTDGVT
CLANPSYVPPPQCQPGEFACANSRCIQERWKCDGDNDCLDNSDEAPALCHQHTCPSDRFK
CENNRCIPNRWLCDGDNDCGNSEDESNATCSARTCPPNQFSCASGRCIPISWTCDLDDDC
GDRSDESASCAYPTCFPLTQFTCNNGRCININWRCDNDNDCGDNSDEAGCSHSCSSTQFK
CNSGRCIPEHWTCDGDNDCGDYSDETHANCTNQATRPPGGCHNDEFQCRLDSLCIPLRWR
CDGDTDCMDSSDEKSCEGVTHVCDPNVKFGCKDSARCISKAWVCDGDSDCEDNSDEENCE
SLACRPPSHPCANNTSVCLPLDKLCDGNDDCGDGSDEGELCDQCSLNNGGCSHNCSVAPG
EGIVCSCPLGMELGPDNHTCQIQSYCAKHLKCSQKCDQNKFSVKCSCYEGWVLEPDGESC
RSLDPFKPFIIFSNRHEIRRIDLHKGDYSVLVPGLRNTIALDFHLSQSALYWTDVVEDKI
YRGKLLDNGALTSFEVVIQYGLATPEGLAVDWIAGNIYWVESNLDQIEVAKLDGTLRTTL
LAGDIEHPRAIALDPRDGILFWTDWDASLPRIEAASMSGAGRRTIHRETGSGGWPNGLTV
DYLEKRILWIDARSDAIYSARYDGSGHMEVLRGHEFLSHPFAVTLYGGEVYWTDWRTNTL
AKANKWTGHNVTVVQRTNTQPFDLQVYHPSRQPMAPNPCEANGGRGPCSHLCLINYNRTV
SCACPHLMKLHKDNTTCYEFKKFLLYARQMEIRGVDLDAPYYNYIISFTVPDIDNVTVLD
YDAREQRVYWSDVRTQAIKRAFINGTGVETVVSADLPNAHGLAVDWVSRNLFWTSYDTNK
KQINVARLDGSFKNAVVQGLEQPHGLVVHPLHGKLYWTDGDNISMANMDGSNRTLLFSGQ
KGPVGLAIDFPESKLYWISSGNHTISRCNLDGSGLEVIDAMRSQLGKATALAIMGDKLWW
ADQVSEKMGTCNKADGSESVVLRNSTTLVMHMKVYDESIQLDHEGTNPCSVNNGDCSQLC
LPTSESTRSCMCTAGYSLRSGQQACEGVGSFLLYSVHEGIRGIPLDPNDKSDALVPVSGT
SLAVGIDFHAENDTIYWVDMGLSTISRAKRDQTWREDVVTNGIGRVEGIAVDWIAGNIYW
TDQGFDVIEVARLNGSFRYVVISQGLDKPRAITVHPEKGYLFWTEWGQYPRIERSRLDGT
ERVVLVNVSISWPNGISVDYQDGKLYWCDARTDKIERIDLETGENREVVLSSNNMDMFSV
SVFEDFIYWSDRTHANGSIKRGSKDNATDSVPLRTGIGVQLKDIKVFNRDRQKGTNVCAV
ANGGCQQLCLYRGGGQRACACAHGMLAEDGAACREYAGYLLYSERTILKSIHLSDERNLN
APVQPFEDPEHMKNVIALAFDYRAGTSPGTPNRIFFSDIHFGNIQQINDDGSGRTTIVEN
VGSVEGLAYHRGWDTLYWTSYTTSTITRHTVDQTRPGAFERETVITMSGDDHPRAFVLDE
CQNLMFWTNWNEQHPSIMRAALSGANVLTLIEKDIRTPNGLAIDHRAEKLYFSDATLDKI
ERCEYDGSHRYVILKSEPVHPFGLAVYGEHIFWTDWVRRAVQRANKYVGSDMKLLRVDIP
QQPMGIIAVANDTNSCELSPCRVNNGGCQDLCLLTHQGHVNCSCRGGRILQEDLTCHAMN
SSCRAQDEFECANGECINFSLTCDGVSHCKDKSDEKPSYCNSRRCKKTFRQCSNGRCVSN
MLWCNGADDCGDGSDEIPCNKTACGVGEFRCRDGTCIGNSSRCNQFVDCEDASDEMNCSA
TDCSSYFRLGVKGVRFQPCERTSLCYAPSWVCDGANDCGDYSDERDCPGVKRPRCPLNYF
ACPSGRCIPMSWTCDKEDDCEHGEDETHCNKFCSEAQFECQNHRCISKQWLCDGSDDCGD
GSDEAAHCEGKTCGPSSFSCPGTHVCVPERWLCDGDKDCADGADESITAGCLYNSTCDDR
EFMCQNRQCIPKHFVCDHDRDCTDGSDESTECEYPTCGPNEFRCANGRCLSSRQWACDGE
NDCHDQSDEAPKNPHCTSSEHKCNASSQFLCSSGRCVAEALLCDGQDDCGDGSDERGCHV
NECLSRKLSGCSQDCEDLKIGFKCRCRPGFRLKDDGRTCADVDECSTTFPCSQRCVNTHG
SYKCLCVEGYAPRGGDPHSCKAVTDEEPFLIFANRYYLRKLNLDGSNYTLLKQGLNNAVA
LDFDYREQMIYWTDVTTQGSMIRRMHLNGSNVQVLHRTGLSNPDGLAVDWVGGNLYWCDK
GRDTIEVSKLNGAYRTVLVSSGLREPRALVVDVQNGYLYWTDWGDHSLIGRIGMDGSGRS
VIVDTKITWPNGLTLDYVTERIYWADAREDYIEFASLDGSNRHVVLSQDIPHIFALTLFE
DYVYWTDWETKSINRAHKTTGTNKTLLTSTLHRPMDLHVFHALRQPDVPNHPCKVNNGGC
SNLCLLSPGGGHKCACPTNFYLGSDGRTCVSNCTASQFVCKNDKCIPFWWKCDTEDDCGD
HSDEPPDCPEFKCRPGQFQCSTGICTNPAFICDGDNDCQDNSDEANCDIHVCLPSQFKCT
NTNRCIPGIFRCNGQDNCGDGEDERDCPEVTCAPNQFQCSITKRCIPRVWVCDRDNDCVD
GSDEPANCTQMTCGVDEFRCKDSGRCIPARWKCDGEDDCGDGSDEPKEECDERTCEPYQF
RCKNNRCVPGRWQCDYDNDCGDNSDEESCTPRPCSESEFSCANGRCIAGRWKCDGDHDCA
DGSDEKDCTPRCDMDQFQCKSGHCIPLRWRCDADADCMDGSDEEACGTGVRTCPLDEFQC
NNTLCKPKCDGEDDCGDNSDENPEECARFVCPPNRPFRCKNDRVCLWIGRQCDGTDNCGD
GTDEEDWEPPTAQTPHCKDKKEFLCRNQRCLSSSLRCNMLDDCGDGSDEEECSIDPKLTS
CATNASICGDEARCVRTEKAAYCAPCRSGFHIVPGQPGCQALNECLRFGTCSQLCNNTKG
GHLCSCARNFMKTHNTCKAEGSEYQVLYIADDNEIRSLFPSHPHSAYEQAFQGDESVRID
AMDVHVKAGRVYWTNWHTGTISYRSLPPAAPPTTSNRHRRQIDRGVTHLNISGLKMPRGI
AIDWVAGNVYWTDSGRDVIEVAQMKGENRKTLISGMIDEPHAIVVDPLRGTMYWSDWGNH
PKIETAAMDGTLRETLVQDNIQWPTGLAVDYHNERLYWADAKLSVIGSIRLNGTDPIVAA
DSKRGLSHPFSIDVFEDYIYGVTYINNRVFKIHKFGHSPLINLTGGLSHASDVVLYHQHK
QPEVTNPCDRKKCEWLCLLSPSGPVCTCPNGKRLDNGTCVAVPSPTPPPDAPRPGTCNLQ
CFNGGCCFLNARRQPKCRCQPRYTGDKCELDQCWEYCRNGGTCAASPSGMPTCRCPTGFT
GPKCTQQVCAGYCANNSTCTVNQGNQPQCRCLPGFLGDRCQYRQCSGYCENLGTCQMAAD
GSRQCRCTAYFEGPRCEVDKCSRCLDGACVVNKQSGDVTCNCSDGRVAPSCLTCVGHCSN
GGSCTMNSKMMPECQCPPHMAGPRCEEQVVSQQQPGHMASILIPLLLLLLMLLVAGVVFW
YKRRVRGAKGFQHQRMTNGAMNVEIGNPTYKMYEGGEPDDVGGLLDADFALDPDKPTNFT
NPVYATLYMGGHGXXXRHSLASTDEKRELLGRGPEDEIGDPLA
Download sequence
Identical sequences G1LDK5
ENSAMEP00000004987 ENSAMEP00000004987

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]